spacer

EBI Dbfetch

ID   AK082475; SV 1; linear; mRNA; HTC; MUS; 2499 BP.
XX
AC   AK082475;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 0 day neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:C230053J22 product:a disintegrin-like and metalloprotease
DE   (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2), full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2499
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1ec9a02245e026367c4d1243b4392439.
DR   Ensembl-Gn; ENSMUSG00000022894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023611; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C230053J22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2499
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C230053J22"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1873
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="a disintegrin-like and metalloprotease (reprolysin
FT                   type) with thrombospondin type 1 motif, 5 (aggrecanase-2)
FT                   (MGD|MGI:1346321 GB|NM_011782, evidence: BLASTN, 99%,
FT                   match=2058)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BGP4"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR013273"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1346321"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGP4"
FT                   /protein_id="BAC38503.1"
FT                   /translation="ENHIRLAVVKVVVLTDKDTSLEVSKNAATTLKNFCKWQHQHNQLG
FT                   DDHEEHYDAAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHE
FT                   IGHLLGLSHDDSKFCEENFGTTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGN
FT                   CLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVC
FT                   LTKKLPAVEGTPCGKGRVCLQGKCVDKTKKKYYSTSSHGNWGSWGPWGQCSRSCGGGVQ
FT                   FAYRHCNNPAPRNSGRYCTGKRAIYRSCSVTPCPPNGKSFRHEQCEAKNGYQSDAKGVK
FT                   TFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFSPKVTDGTECRPYSNSVCVRGRCVRT
FT                   GCDGIIGSKLQYDKCGVCGGDNSSCTKIIGTFNKKSKGYTDVVRIPEGATHIKVRQFKA
FT                   KDQTRFTAYLALKKKTGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYS
FT                   ATKEILIVQILATDPTKALDVRYSFFVPKKTTQKVNSVISHGSNKVGPHSTQLQWVTGP
FT                   WLACSRTCDTGWHTRTVQCQDGNRKLAKGCLLSQRPSAFKQCLLKKC"
XX
SQ   Sequence 2499 BP; 727 A; 563 C; 623 G; 586 T; 0 other;
     ggagaaccac atccgcctgg cggtggtgaa ggtggtggtg ctgacggaca aggacacgag        60
     tctggaggtg agcaagaatg cggccacgac cctcaagaac ttttgcaaat ggcagcacca       120
     acataaccag ctaggggatg atcacgaaga gcactacgat gcagccatcc tgttcacccg       180
     agaggattta tgtgggcatc attcatgtga caccctggga atggcagacg ttgggaccat       240
     atgttctccg gagcgcagct gtgcagtgat tgaagatgat ggcctccatg cagccttcac       300
     tgtggctcat gaaattgggc atctacttgg cctttctcat gacgattcca aattctgtga       360
     agagaacttc ggtactacag aagacaagcg tttaatgtct tcaatcctta ccagcatcga       420
     tgcatccaag ccctggtcca aatgcacgtc agccaccatc acagaattcc tggatgatgg       480
     tcatggtaat tgtttgctag acctaccacg gaagcagatt ttgggtcccg aggaactccc       540
     aggacagacc tacgatgcca cccagcagtg caacttgaca tttgggcctg agtactcggt       600
     gtgccctggc atggatgtct gtgcgcggct gtggtgtgct gtggtgcgcc aaggccaaat       660
     ggtgtgtctg accaagaagc tgccggctgt ggagggcact ccctgtggga agggaagagt       720
     ctgccttcaa ggcaaatgtg tggacaaaac taagaaaaaa tattactcga catcaagcca       780
     tggaaattgg gggtcctggg gcccctgggg tcagtgttct cgctcatgcg ggggaggagt       840
     gcagtttgcc taccgccatt gtaataaccc tgcacctcga aacagtggcc gctactgcac       900
     agggaagagg gccatatacc gttcctgcag tgttacaccc tgcccaccca atggtaaatc       960
     ttttcgccat gagcagtgtg aagccaaaaa tggctatcag tctgatgcaa aaggagtcaa      1020
     aacatttgta gaatgggttc ccaaatatgc aggtgtcctg ccggcagatg tgtgcaagct      1080
     tacctgcaga gctaagggca caggctacta tgtggtcttt tctccaaagg ttacggatgg      1140
     gactgaatgc aggccgtaca gcaactctgt gtgtgtccga ggacggtgtg tgagaactgg      1200
     atgtgacggc attattggct caaagctaca atatgacaag tgtggagtgt gcggagggga      1260
     taactccagt tgtacaaaga ttatcggaac cttcaataaa aaaagcaagg gttatactga      1320
     cgttgtgagg atccctgaag gagcaaccca cataaaagtc cgacagttca aagccaaaga      1380
     ccagactaga ttcactgcct acttagccct gaagaagaaa actggcgagt accttatcaa      1440
     tggcaagtac atgatttcca cttcagagac catcatcgac atcaatggta ccgtcatgaa      1500
     ctacagtgga tggagccaca gagatgattt tttacatggg atgggctatt cagccacaaa      1560
     agaaatcctg atcgtgcaga tccttgccac agacccaact aaagcgctag acgtccgtta      1620
     cagctttttt gttcccaaga agaccactca aaaagtaaac tctgtcatca gccatggcag      1680
     caacaaggtg ggaccacact ctacacagct gcagtgggtg acaggtccat ggctggcctg      1740
     ctccaggacc tgtgacacag gctggcacac taggaccgtg cagtgccagg atggaaacag      1800
     gaaattagct aaaggatgcc ttctctctca gaggccttct gcatttaagc aatgtctgct      1860
     gaagaaatgt tagcctgtgg tttactctaa tgcacaaaaa aacaacagga ggatcatcgc      1920
     agatacagct gtggtgaaga caaggcctac ccaaagcaca gaaagtcatg ccttcatgtc      1980
     attgtcacca cgagtcgaat tatgggcaga atctgctctc tgcgaccaaa aggtttactc      2040
     tacttggtgt aatgatggtg accttggaat aaagaaaacg tgagggtcat ggaacatccc      2100
     tgggcctaca caaaggagac acacaatgat gaatgtagaa tcggggacat ttgaagatgg      2160
     cagagaagtc ttgtcaccta cctcttatag aatgtcttca aagacatcgt gatcatgttc      2220
     agccatgaca cacagcttat ttttactgtt tgtaaatgca tccgccctta gtatgtcact      2280
     ttataaactt ggtcctatta atatatacac atgtgtaaat acaatatata tatttgacca      2340
     aagtaggtct gcagctattt caactactat tttccagaaa aagctgaaga agatttactg      2400
     gaaattaaga acttgctgct gttaaataaa actttgtata ttgtcagcct gcaggagata      2460
     acattttagt caaaaaaaaa aaaaaaaaga aaaaaaagg                             2499
//


spacer
spacer