spacer

EBI Dbfetch

ID   AK082016; SV 1; linear; mRNA; HTC; MUS; 2908 BP.
XX
AC   AK082016;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130095B09 product:5-HYDROXYTRYPTAMINE 1D RECEPTOR (5-HT-1D)
DE   (SEROTONIN RECEPTOR), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2908
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000070687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121571; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130095B09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2908
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130095B09"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             972..2096
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-HYDROXYTRYPTAMINE 1D RECEPTOR (5-HT-1D) (SEROTONIN
FT                   RECEPTOR) (SWISSPROT|Q61224, evidence: FASTY, 99.2%ID,
FT                   100%length, match=1122)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61224"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000505"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96276"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61224"
FT                   /protein_id="BAC38393.1"
FT                   /translation="MSPPNQSLEGLPQEASNRSLNVTGAWDPEVLQALRISLVVVLSVI
FT                   TLATVLSNAFVLTTILLTKKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFG
FT                   QILCDIWVSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAAAMIAAVWIIS
FT                   ICISIPPLFWRQATAHEEMSDCLVNTSQISYTIYSTCGAFYIPSILLIILYGRIYVAAR
FT                   SRILNPPSLYGKRFTTAQLITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLADS
FT                   ILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTW
FT                   LGYLNSLINPVIYTVFNEDFRQAFQKVVHFRKIS"
FT   polyA_signal    2892..2897
FT                   /note="putative"
FT   polyA_site      2908
FT                   /note="putative"
XX
SQ   Sequence 2908 BP; 655 A; 760 C; 685 G; 808 T; 0 other;
     gaagcaaggc gtggaatagc tgctgagttc tcagtgtgct ggtgtgccag atgtcaaaca        60
     gctgtgtggg tgctggtggg tgtttccgga tctccctatg cactcccccc aaaggagact       120
     caaagacaca acttttacca gggatgaaga gtcgcggtca cttcatgatg ctaatagggt       180
     caattcatca agaacacata accagtctac tggtggatgc tggtgataac aagacatgag       240
     aatatacaaa cacctcagag ctaccaagca cagctcggtg aaccagcggt gacccatttg       300
     ttttgcctcc ttctagctca tgcattcttt gagtcttggt cacgggaatg ttttgtctgg       360
     tcagacgcaa agccgtcagc aggacagaac caacgcgtga acactcatga tgtgtcggcc       420
     aggggccctg ggaaaaggca gctcctggtg gcgcaccctc tgaatcagct gtttcttttt       480
     gtctctggct ttaaaagctc tctggaactg acctgatatc cagagtcttc tccaagtatg       540
     aacagggaaa cgaagttttc gttaaatatg ttgacgtctt atgttttgaa aagcagtaga       600
     gtgtcaaagg cgagaacccc agaatcctgc ccatcctcct gtgagacctt ggtaattatc       660
     taacaaactt atcatgtgtc cactgggctg gaccatctgc caggaggagt cccagaaacc       720
     caagatgcct tggggtttat ctgcttccgg aagcagctag ccgtggttgt ggtgttcttc       780
     cctgcccacg tcttgagttt tagttttttt gttttgtttt gttttttgtt tttttttttt       840
     ctgtgctccg tcctgatgta tacggccttc acagttgtga agccaaagga tgaccttgct       900
     ctgtggatcg gactgcggtg aaggagcgag ccgtgtgtgt agaagtctgt gggaagagac       960
     gagcactgag catgtctcct ccaaaccagt ccctagaagg ccttcctcag gaggcctcca      1020
     acagatccct gaatgtgaca ggggcttggg acccagaggt cctgcaggct ctcagaatct      1080
     cgctcgtggt ggtgctgtcc gtcatcacac tggccactgt cctctccaat gccttcgtcc      1140
     ttaccaccat tctactcacc aagaagctcc acaccccagc caattatctc attggctcct      1200
     tggccaccac ggacctcctg gtttctatct tggtcatgcc catcagcata gcctacacca      1260
     ccacccgcac ctggaacttt ggccagatcc tgtgtgacat ctgggtgtct tctgacatca      1320
     cgtgctgcac ggcctccatc ttgcatctct gtgtcattgc tctggacaga tactgggcca      1380
     tcaccgatgc cctggagtac agcaagcgtc gaaccgcagg ccacgcagca gccatgattg      1440
     cggccgtctg gatcatctct atttgtatct ccatccctcc actcttctgg cggcaggcca      1500
     cggctcacga ggagatgtcc gactgcctgg tgaacacatc tcagatttct tacaccatct      1560
     actcgacctg tggcgccttc tatatcccat ccatcttgct cattatcctg tatggccgca      1620
     tatacgtggc cgcccggagt cgaatcctga acccaccctc cctctacggg aagcgcttca      1680
     ccacggcaca gcttatcaca ggctctgctg gctcttcgct ctgctcgctc aaccccagcc      1740
     tccatgagag ccacacacac acagttggct cccctctctt tttcaaccag gtgaaaatca      1800
     agcttgctga tagcatccta gaacgcaaga ggatctctgc agcccgagaa aggaaagcca      1860
     ctaagaccct gggcatcatt ctgggggcct ttatcatctg ctggttgcct ttctttgtag      1920
     tatcattggt cctccccatc tgcagggact cttgttggat ccacccggcc ctctttgact      1980
     tcttcacgtg gctaggttat ttaaactctc tcattaaccc cgtcatctac actgtgttca      2040
     acgaagactt tcgacaagcg tttcagaaag tcgtccattt ccggaagatc tcatagtcgg      2100
     atttgggggt gactcttgtt tgcctgttat gtcctgtaac cccactgggg ttgccttttt      2160
     aaaaattact gccatttctc tgagacccgg gttgatttgt gctatcttgg gtctttggct      2220
     taaattaata gatttgttct gtgtttgatt gccagcatcc tccagacccc tgaatcatct      2280
     aaagctaggt cactgtgttg tgtaaagggg agacaggact gacagcatcc cttaacataa      2340
     tattctcatg gttctctggg ttggaagaaa tataactgta ggacccaggt gagaaaatgt      2400
     ctttctctct agcaggcttg gagggaaggc cttctggtct acctgggatt ttacagagtt      2460
     tttgagaatg ggtgtgatta ctgacttgaa ttaaaaaaga atttggagtt agaaaggagg      2520
     ggttgtcatc tcctggagct cattgattag aagataacac ccaggaattg tttccactgg      2580
     gtcctggctg tccataagga aagtggtatc agtggcccag cgtagatgga gagaaagtca      2640
     gaaagaggca gcaggagaga ggtatacttg ggaccagatc agctctgcat ccttcattct      2700
     tccctctgtc tctattacgc aatgttccga agttaaaacc caccatcctg ccgctcaaga      2760
     agactgaccg gtacgggaca ctcgaggctt tgaatgggac accctattct gccttttttg      2820
     atttttttcc cctgaattat tcttttttac aacccttgtc cttggagttc ttaagatgtt      2880
     gagcgttacc aaataaaccg catgagac                                         2908
//


spacer
spacer