Dbfetch

ID   AK081908; SV 1; linear; mRNA; HTC; MUS; 1889 BP.
XX
AC   AK081908;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130086F02 product:vesicle-associated membrane protein, associated
DE   protein B and C, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1889
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c64daed9cd015d1aa10fbd631faad5da.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026961; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0026928; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026899; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026937; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026679; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027384; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026138; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026656; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026794; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026760; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026895; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027441; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026210; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059580; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059613; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059554; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059544; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059235; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060013; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059521; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059209; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059317; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059294; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059423; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059281; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060197; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058514; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130086F02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1889
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130086F02"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             52..783
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="vesicle-associated membrane protein, associated
FT                   protein B and C (MGD|MGI:1928744 GB|NM_019806, evidence:
FT                   BLASTN, 99%, match=732)"
FT                   /db_xref="GOA:Q8BH80"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="InterPro:IPR030226"
FT                   /db_xref="MGI:MGI:1928744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH80"
FT                   /protein_id="BAC38368.1"
FT                   /translation="MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVK
FT                   TTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEA
FT                   VWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDD
FT                   TEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSA
FT                   RLLALVVLFFIVGVIIGKIAL"
XX
SQ   Sequence 1889 BP; 468 A; 449 C; 546 G; 426 T; 0 other;
     gacccaggcc gccgcccccc gcccgcgccg tcgcccccga cggggaggac catggcgaag        60
     gtggaacagg tcctgagcct cgagccacaa cacgagctca agttccgagg tcccttcact       120
     gatgttgtca ccaccaacct aaagcttggc aacccaacag accgaaatgt gtgttttaaa       180
     gtgaagacca cagcacctcg caggtactgc gtgcggccca acagtggggt cattgatgcc       240
     ggggcctctc tcaatgtgtc tgtgatgtta cagcctttcg attatgatcc caatgagaaa       300
     agtaaacaca agtttatggt tcagtctatg tttgctccgc ctgacacttc tgatatggag       360
     gcagtatgga aggaggcaaa accggaagac cttatggatt caaaacttag atgtgtgttt       420
     gaattgccag cagaaaatgc taaaccacat gatgtagaaa taaataaaat catacctacg       480
     agtgcatcca agacagaagc accggcagcc gcaaagtccc tgacatcgcc cctcgatgac       540
     acagaagtaa agaaggtgat ggaagagtgc aggcggctgc agggggaggt gcagaggctt       600
     cgggaggaga gcaggcagct caaggaagaa gacggacttc gggtgaggaa ggcgatgccg       660
     agcaacagcc ccgtggcggc tctggcggcc actgggaagg aggagggcct gagcgcccgg       720
     ctgctggccc tggtggttct gttctttatc gttggtgtca ttatagggaa gattgccttg       780
     taggggccgc atgcgaagga tggcaggttg gattgatgga tctaccacac catgggattc       840
     aaatttatca taaccatgcg taaaaagaaa ttaatgtatg acggcatctc acaggtcttg       900
     cctttaaata cccctcccca tgcacacaca aatgcacaca caaatatagc ataatataat       960
     gatcttttag aaagttaaaa atgtataggg aatggatggg gaaagaatgg tctgttgccg      1020
     taggacgggc cgtgattaac cacagtggca tcttgtagct gtcacgctca attcgggtag      1080
     gcctgggcac gtgttgctag atcactctct taaagcaaga agctcctcct cgcatgttgg      1140
     ggctggcccg tgggagcggg agtcctgcaa ggtggggcga gctgtctttt tcttacccac      1200
     gtggcttccc caggcctgct gttctgtcca ggcatcgtct cctcaggcct acagagctgc      1260
     aggtgccaaa gtgcattgca cagaggccac atctcgtgta cctgtgggtc gtgtgggaga      1320
     gacatgagtg gaccagcggg tccaacacag ggaaatccaa gtctgtgctc tgttctcttg      1380
     aagggaccaa gctaaattac cgctggttca agtagtgaac cgagttgttc tcggagatgg      1440
     ctgatgcaca tgtaacctat ttcatctcgt gtgttcctgc tgccaccaga gcacaggcag      1500
     tgagtgctgc agaccgccag tgaggagctg ctgctgtggg ctctggaggt ctgagggaag      1560
     gggagggtct gagtcaggaa gtgttttgtt gtaggtcagt aatagctgcc ctgaggagga      1620
     acgctctttt taatgacagt cagctctgga ttacccagtc ttctagattg ccctaccatc      1680
     catccttcta aaacataggc cagccttgac ctgcccttct caggatgagt gagtcaggct      1740
     gcagagggtg aagggcatag agggggtggg gtggggtggg ggagccctca gcaaatccat      1800
     ctgctggtga tgaagagtcc tgactgtgaa ttaatttcat gccataaaag accgatccag      1860
     ttctgctcaa ctatgtagca tcttaaagg                                        1889
//