spacer

EBI Dbfetch

ID   AK081877; SV 1; linear; mRNA; HTC; MUS; 3216 BP.
XX
AC   AK081877;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130084C09 product:glycoprotein m6a, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3216
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f4b4028c30dbd6c3edd92ee0faedcde5.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130084C09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3216
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130084C09"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             438..1274
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glycoprotein m6a (MGD|MGI:107671 GB|S65735,
FT                   evidence: BLASTN, 99%, match=1195)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542P2"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/TrEMBL:Q542P2"
FT                   /protein_id="BAC38356.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
FT   polyA_signal    3187..3192
FT                   /note="putative"
FT   polyA_site      3216
FT                   /note="putative"
XX
SQ   Sequence 3216 BP; 886 A; 603 C; 652 G; 1075 T; 0 other;
     gctgttcaca gttcagcctg cttccagttt aaagccgaga tttcagcaca aacctcaatt        60
     tctttccccc attttaaatg caaagcgagg cttgtgaatc acagtgtctc tgctcctaga       120
     atccagaccc ctttccactc cccctcccaa aattatccgg ctgtttgttt gagtacctgc       180
     ttactgtggc acacacaatg ggcagctttg agaagaaaaa ttgataatct tcacggaaga       240
     gtaatttgaa tgaaattaca cttgacagcc agtctctaag caaacaagag gcgcgaggga       300
     gcctcagcta agctccaagg acttgcccaa gccactgctg ctggagctgc ccagggaaaa       360
     aaggcacacg cttttttgac atctaattga gcttttgact aataccgtgc gccagattct       420
     cctgaagaaa ggtagccatg gaagagaata tggaagaagg acagacacag aaagggtgct       480
     tcgagtgctg cattaaatgc ctgggaggta ttccctatgc ttctctgatt gcaaccatcc       540
     tgctgtatgc aggcgttgcc ctgttctgtg gctgtggcca tgaagccctt tctggaacag       600
     tcaacattct gcagacctac tttgagttgg caaggactgc tggagacaca ctggatgttt       660
     tcactatgat tgacatcttt aagtatgtga tctatggcat tgcggctgct ttctttgtct       720
     atggcatttt actgatggta gaaggtttct tcacaactgg ggctatcaaa gatctctatg       780
     gagacttcaa aatcaccacc tgtggcagat gtgtgagcgc ttggtttatc atgctgacat       840
     acctcttcat gttggcctgg ctgggagtca cagctttcac ctcactgccc gtgtacatgt       900
     atttcaatgt gtggaccatc tgccggaaca ccactctagt ggagggagca aatctctgct       960
     tggatctgcg tcagtttggg attgtgacaa ttggagagga aaagaaaatt tgtactgcct      1020
     ctgagaactt cctgaggatg tgtgaatcta ctgagctgaa tatgaccttc cacttgttca      1080
     ttgtggcact tgctggagct ggagcagcag ttattgctat ggtccactac ctgatggttc      1140
     tgtctgccaa ctgggcctat gtgaaagatg cctgccgcat gcagaagtac gaagacatca      1200
     agtcaaagga agagcaggag ctgcacgaca tccattctac tcgctccaaa gagcggctca      1260
     atgcgtacac ataaatacgc ttctctgttc cttaccactc gaaggcattg gtgtttcatt      1320
     aagggccatc caaccatcca acctgtgaag agcaaaacga gaatgctact catcaaagat      1380
     gcgcagggtg actaatgaat cacctgagta taactctttg ctgttgagca ttccatcttc      1440
     taatttgtta aattggaatg accaaatctc ctctacaagc tcctattcag tctttttttt      1500
     taacctctca aattgattta gttcttctgt atgatcaaag atattaacat tgtccaacgc      1560
     aaatctttgt ttgattttta atcacctccc acatatcaca cataacactt tttgcattgt      1620
     ttcttatgtt ttggaagaga aaatagcttt ttttatactt tttagttttg atttcagtaa      1680
     ctagtttaac tacaggtaac cttcaaaggg accgttgtac attatgaaag agagacagag      1740
     atggtatcat gatgactccg cttgatatgg gaatcagtct ggagagatca gtggccacac      1800
     ggctatcggc catggttaat gttttcatcc atctaaggtg caatttcaaa atttctaagg      1860
     gtaggttaaa aaaaagtgct tcttatcttt gttaacattg tattcttttt tcttgatgtt      1920
     cgtaaaaggt atttctctga ttactcatgt ttatgttgtg agcatgtaga aacagtaatg      1980
     ctaatgcatg gccagttgcc ttcctaagat tgtgacacca ggcttacctt ttcaagttta      2040
     gtatagaaac aattatcatg gaaataacta ctgtggactg ttggagagtg atcttttttt      2100
     gtgatttatg cagtggctgg attggatctt ttaatatgct aatgtggaaa attaattacc      2160
     tttatgaagg tggtatctta aacataagca cactaaaccc tcaagacttg ttttacccac      2220
     ttaaaacttt taacggattg cacctctgta agctatttct taaaatgtgt atgatatatt      2280
     tgaaaagact tccattaata taatagcttt gcttgcagcc ttccaatcta tgttggttta      2340
     cctgtagtgt ttctaaaggg tggtcagagg ccactagaga atgtattgtt tgggagtgta      2400
     gtgatatata ttttgtgttt ttatttcaag taagtcattt taaccaaatg ttcattcaca      2460
     ttcatttata agaagtacct atatcagaca aattttaaaa gaaaaacaat cagtattaat      2520
     ggaccaaatt tcgtgtttgt tttaaccttg actctctttt gattctttct aatgctacaa      2580
     gaatgctgtg aaatgtcatt taaaataatg atgtagcctg acaagaaatt ttgtcagtgt      2640
     ataaacctag gtagtattgt gcactgattt gaccattgtg aattcctcct tcagtgtaag      2700
     tgcattccca ataaaattta ttgagtgaaa caatctttgt acaactacta gtcatgcatc      2760
     atcagtaatt ttacaagttc ttgtagtagg tagggggtat tactagcgtt tctgtggcat      2820
     gattatgcat tctgtaatat taatttgggg gtccttttgc tttttaacac ttagattatc      2880
     ttaatggttc aacatttttc tgatatatgc agtattaaag atattgagca aaagtattaa      2940
     tgggcttctt taaattctat attatagtgt ttcagttctg tgtctacagt gtgtgatgat      3000
     ttttaaaact gtcttttaaa tttatgtaat gatgttgaca ttttgacttt tatttctggt      3060
     tttagagttt gtattttcat ggagtgcttt gtagcaggca ttacaagtaa tctgttttgt      3120
     acataaatgt gccaacagct tgatggtggc gtttttgaaa tgtagaacaa agtgcttgca      3180
     aaatgtaata aatacacttg tgtactttgt gtacct                                3216
//


spacer
spacer