spacer

EBI Dbfetch

ID   AK081482; SV 1; linear; mRNA; HTC; MUS; 2328 BP.
XX
AC   AK081482;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130020D04 product:myosin heavy chain (fragment) homolog [Gallus
DE   gallus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2328
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c4677877c5cb52bba7ae0b30b5949c25.
DR   Ensembl-Gn; ENSMUSG00000055775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108685; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130020D04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2328
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130020D04"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             96..683
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="myosin heavy chain (fragment) homolog [Gallus
FT                   gallus] (PIR|B25217, evidence: FASTY, 93.4%ID, 98.8%length,
FT                   match=498)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BGE8"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGE8"
FT                   /protein_id="BAC38229.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPGV
FT                   LYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDN
FT                   AYQFMLTVISTLGCERGHSGIHWPAQANRASK"
FT   polyA_signal    2309..2314
FT                   /note="putative"
FT   polyA_site      2328
FT                   /note="putative"
XX
SQ   Sequence 2328 BP; 715 A; 515 C; 450 G; 648 T; 0 other;
     gatctccgcc aagagcccag agtgaaggac aggcgtgact ctacgttttc atccagagct        60
     ccatagctga aacctcggct aaataagtag cagccatgag tgcgggttcg gacgcggaga       120
     tggctatttt tggcgaagct gctccttacc tccgaaaatc ggagaaggag aggattgagg       180
     cccaaaataa gccttttgac gcaaaaacat ctgtctttgt ggcggagccc aaggagtctt       240
     atgtgaaaag cgttatacaa agcaaggatg gagggaaagt gaccgtgaag acggaaagtg       300
     gagcaactct caccgtcaag gaagatcaag tcttccccat gaaccctccc aaatatgaca       360
     agatcgagga catggccatg atgacccacc tccatgagcc cggagtgctg tacaacctca       420
     aagagcgtta tgcagcctgg atgatctata cctactcagg cctcttctgt gtcaccgtca       480
     acccctacaa gtggctgccg gtgtacaacc ctgaggtggt ggcagcctac cgaggcaaaa       540
     agcgccagga ggccccaccc cacatcttct ccatctctga caacgcctac cagttcatgc       600
     tgacggtcat ctccacttta ggatgtgaac ggggacactc tggaattcac tggcctgccc       660
     aagccaacag ggctagcaaa taacaactca gataaagcaa agagccagtt tctgaaaaca       720
     gatttgttca ttttttttcc aacttggata caaaaaagtt caaacagatc cctttaaaag       780
     taccttctca acagcctaaa aaagaggtct caggcatatc cagagaactc tgaattctta       840
     tgtggatttt caaatgacac agccgatgat gccagctttg gagacagagc aagagtaagc       900
     tggagataga gcatggataa agagaactta ttaaattcct cccatggact ttgaaacatt       960
     ctcctattca agtctgctag ttctgcatta tcaaagcaca ctcatgatcg gtcccagaac      1020
     agcactaaaa ccttttatct tcacatataa atgcctctgg atatgttctc agttcccatg      1080
     ttccctttct tctgtggagt tttggtacct gggcacattt ctttttttgt tttctgttca      1140
     ttttgttgtt cttgctcata gattgtcttt taaagggggt gggggtaggg aaagtgacac      1200
     accagggacc ccccccacta tgacagactg gcctggactt tcacaaggac tctgtgccct      1260
     ccttcctcaa agttaccccg gtgttggctt ccgccggagg ttatagtatc cagaaactgc      1320
     catatccacc gccaccgaat gactctccag gctttggagc taccccaaat ttaaagtcgc      1380
     ctgggctccc aatcacactt ttcatacaaa tctgttcaga accatggcat cgatctgctt      1440
     agtgttatcc caatattggc tgaagcgctg agccattgct ttcctgtctg ttctcctaga      1500
     tgcaatacag ttgtacatga ttttattaga aaaagaagac aatctcatac atccaaaatc      1560
     catacccatt tccttgaaca gaagctcaag gtttttaaag tctaagtgtg ttcatacatc      1620
     taaataacat gtagatttgt attggttatc tctagaaata cttttaaatt tagaagtttc      1680
     aaaaatccag tctatcaata cagaattgta gagttgataa actagaaatt tgataaaata      1740
     cattattaca tagagataaa tatctatatt aaagagaaat aaagttaagt taattaatta      1800
     attaattata tagctaatta attaattagg ccacttctta tttggcatca ccagtagtca      1860
     aattagtgac atgaaaaact ggacagagaa caagaagttg aaaaataggc aaaatggaag      1920
     tcaaaatacc tgactatctt caaccttaac tagttctgta actcacattt aagaagccat      1980
     tttctcttct aagtcttagc ttcactgtct gctaagtggg agattttacc taagcaacat      2040
     ctaaggtctc taatgacttc ataatcctgc aactgttact ccttataact aaaatcacct      2100
     gatgtctgag gttttcttca aaataaccca gagaggttgg aatagcatag taatgccatg      2160
     aaattggcca agtattaatg actattactc tgtagggcag gtgcccaaag tctcattatc      2220
     atagtctctg ctcttacgtg catttaaatg ttcttataac ataatttttt aaagtaaaaa      2280
     aaatccacct atgtatttgg ataactacaa taaaaaataa agtagtag                   2328
//


spacer
spacer