spacer

EBI Dbfetch

ID   AK081181; SV 1; linear; mRNA; HTC; MUS; 2434 BP.
XX
AC   AK081181;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 10 days neonate cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:B930097N13 product:type 1 tumor necrosis factor receptor
DE   shedding aminopeptidase regulator, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2434
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000021583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169114; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=B930097N13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2434
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="B930097N13"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             103..1752
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="type 1 tumor necrosis factor receptor shedding
FT                   aminopeptidase regulator (MGD|MGI:1933403 GB|NM_030711,
FT                   evidence: BLASTN, 99%, match=1711)"
FT                   /db_xref="GOA:Q8C4S7"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4S7"
FT                   /protein_id="BAC38159.1"
FT                   /translation="MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPE
FT                   YMTPIHYDLMIHANLSTLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEML
FT                   SEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEM
FT                   RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIE
FT                   DHFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMKGSERFPETG"
FT   polyA_signal    2415..2420
FT                   /note="putative"
FT   polyA_site      2434
FT                   /note="putative"
XX
SQ   Sequence 2434 BP; 724 A; 504 C; 506 G; 700 T; 0 other;
     gcactttcac tttcggtccc gggcggccag actggcggct gtgatgaagg taatttgagc        60
     aagaagatag tgtctctgct cctcaaatag ccacttgcaa gcatgccctc tcttcttccc       120
     ctagtattga catttttatc tgtgtcatct ccttcttggt gtcagaacag tgatatagaa       180
     tctctaaaag ctagtaatgg agactcattc ccttggaata atatgcgact tcctgagtat       240
     atgaccccga ttcattatga tctcatgatc catgcaaacc tcagcactct gactttctgg       300
     ggaaaaacag aagtagaaat catagctagc cggcccacga gcaccattat tatgcatagt       360
     caccacctgc aaatatctaa ggccaccctc agaagaggag ctggagagat gctgtctgaa       420
     gaaccactga aggtcctgga atatcctgct catgagcaag ttgcactgct ggctgcccag       480
     ccgcttcttg ctgggtccct gtacacagtt atcatcgact atgctgccaa cctgtctgag       540
     agtttccatg gattctataa gagcacctac agaacacagg aaggtgaaat gagaatactt       600
     gcagcaacac agtttgaacc cacagctgct agaatggctt ttccctgctt tgatgaacct       660
     gccctcaagg caagtttttc catcaagata aagagggatc caaggcacct ggccatctcc       720
     aacatgcccc tggtgaaatc tgtgaatgtt gctgaaggac tcatagaaga ccattttgac       780
     atcactgtga agatgagtac ctacctagtg gccttcatca tttctgattt taagtctgtg       840
     agcaagatga ctaagagtgg agtcaaggtt tctgtgtatg ctgtgccaga caagataaat       900
     caagccgatt atgctctgga tgctgcagtg actcttctag agttttatga ggattatttc       960
     aacattccat atcctttacc caagcaagat cttgctgcaa tcccagactt tcagtctggt      1020
     gctatggaaa actggggact gaccacatac agagagtcct ctctgttata cgataaagaa      1080
     aagtcttctg catctagtaa gcttggcatc acaatgattg tgtcccatga actggctcac      1140
     cagtggttcg ggaacctggt caccatggaa tggtggaatg acctttggct caatgaagga      1200
     tttgccaaat ttatggagtt tgtgtctgtc actgtgaccc atcctgaact aaaagttgaa      1260
     gactatttct ttggcaagtg ttttaatgca atggaagttg atgcattaaa ctcctctcac      1320
     cctgtatcca cacctgtgga gaatcctgcg cagattcggg agatgtttga tgatgtttct      1380
     tatgaaaagg gagcttgtat tctgaatatg ctaagagatt atctgagtgc agatacattt      1440
     aaaagaggaa ttgtacagta tctccaaaag tatagttata aaaacacaaa aaacgaggac      1500
     ctgtggaata gcatgatgca tatttgccct acagatggca cacaaacaat ggatggcttc      1560
     tgctctagaa gccaacactc atcatcaacc tcacactggc gtcaggaggt tgtagatgta      1620
     aagaccatga tgaacacatg gacactgcag aagggctttc ctctgataac catcactgtg      1680
     agtgggcgga atgtgcacat gaagcaagaa cactacatga agggttcaga acgcttccca      1740
     gagactgggt aatgttcaca gtgggaatct ctttctgggt gggatacaat cttcgttttg      1800
     aagcctggcc ctcactcctt cccttgactg cttcagctga aactgtgtgt cctatacagt      1860
     tgaccctacc ttcccaaaag gattcagagg ctttgagtct ctgtaaaacc tatcattttc      1920
     acattctccc attttgcagt ttaataggat gttgtttcta gttgttggcc tgaagccagc      1980
     tctgatctaa gtaggcagtt gctgtgaagt cacagtagtc actaacattg actggagttg      2040
     acgaaaaaat tcatgtaatt tccaggaatt aagaaatatt cagttctcca gaagtctgac      2100
     ttacagccta gaagacctta gcatgtgccc tcgaagagta ttattagaaa tgatgtgttg      2160
     taacttataa aatatttgat gtatcttaaa ctaattcaat cagaacataa ctaaagtgcc      2220
     aaaaatgtgt atatatgctt tatacagcta tgtattacac tcaagttatg atgatatgtg      2280
     tatatatata aagaaagcat tttgtaatat atatataact ttcatttaga caatatgaat      2340
     gttacaatat attatgtata tcaaaatgta tagagaagta ttttcaagaa aataaaaaca      2400
     tttcaaaatt aggaaataaa cttgacaaaa tatc                                  2434
//


spacer
spacer