Dbfetch

ID   AK080241; SV 1; linear; mRNA; HTC; MUS; 1591 BP.
XX
AC   AK080241;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male aorta and vein cDNA, RIKEN full-length enriched
DE   library, clone:A530087O16 product:BETA-2 ADRENERGIC RECEPTOR, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1591
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; efc228d382387c2493d087a619d32bea.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024455; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024425; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024454; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024222; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024901; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023695; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024192; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024322; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024406; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024317; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024948; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023438; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023759; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049845; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049827; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049790; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049783; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050272; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049641; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049450; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049544; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049521; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049673; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049516; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049239; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048812; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A530087O16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1591
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A530087O16"
FT                   /tissue_type="aorta and vein"
FT                   /db_xref="taxon:10090"
FT   CDS             228..1484
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="BETA-2 ADRENERGIC RECEPTOR (SWISSPROT|P18762,
FT                   evidence: FASTY, 99.8%ID, 100%length, match=1254)"
FT                   /note="putative"
FT                   /db_xref="GOA:P18762"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000332"
FT                   /db_xref="InterPro:IPR002233"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:87938"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18762"
FT                   /protein_id="BAC37856.1"
FT                   /translation="MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVL
FT                   AIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNF
FT                   WCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGL
FT                   TSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRV
FT                   FQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGT
FT                   FTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELL
FT                   CLRRSSSKTYGNGYSSNSNGRTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTV
FT                   PSLSVDSQGRNCSTNDSPL"
FT   regulatory      1563..1568
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1591
FT                   /note="putative"
XX
SQ   Sequence 1591 BP; 364 A; 447 C; 415 G; 365 T; 0 other;
     ggcactgcaa ggctgcttct caggcattca ggctgcggct gcaggcaccg cgagcccgga        60
     gcacccacga gctgagtgtg caggacgcac cccagcacag ccacctacgg ccgctgaatg       120
     aagcttccag gagtccgccc ccggccggct gcgccccgtc ggaggtgcac ccgctgagag       180
     cgcctgggca ccgaaagccg gtgcgctcac ctgctaacct gccagccatg gggccacacg       240
     ggaacgacag cgacttcttg ctggcaccca acggaagccg agcgccagac cacgacgtca       300
     ctcaggaacg ggacgaagcg tgggttgtgg gcatggccat cctcatgtcg gttatcgtcc       360
     tggccatcgt gtttggcaac gtgctggtca tcacagccat tgccaagttc gagcgactac       420
     aaaccgtcac caactacttc ataatctcct tggcgtgtgc tgatctagtc atgggcctag       480
     cggtggtgcc gtttggggcc agtcacatcc ttatgaaaat gtggaatttt ggcaacttct       540
     ggtgcgagtt ctggacttcc attgatgtgt tgtgcgtcac agccagcatc gagaccctgt       600
     gcgtgattgc agtggatcgc tatgttgcta tcacatcgcc cttcaagtac cagagcctgc       660
     tgaccaagaa taaggcccga gtggtcatcc tgatggtatg gattgtatct ggccttacct       720
     cctttttgcc tatccagatg cactggtacc gtgccaccca caagaaagct atcgattgtt       780
     acaccgagga gacttgctgt gacttcttca cgaaccaggc ctacgccatc gcgtcctcga       840
     ttgtgtcttt ctacgtgccc ctggtggtga tggtctttgt ctattcccgg gtcttccagg       900
     tggccaaaag gcagctgcag aagatagaca aatctgaagg aagattccac gcccaaaacc       960
     tcagccaggt ggagcaggat gggcggagcg gccacggact ccgaaggtcc tccaagttct      1020
     gcttgaaaga gcacaaagcc ctcaagactt taggcatcat catgggcaca ttcaccctct      1080
     gctggctgcc cttcttcatt gtcaatatcg tgcacgttat cagggacaac ctcatcccta      1140
     aggaagttta catcctcctt aactggttgg gctacgtcaa ctctgccttc aatcctctta      1200
     tctactgtcg gagtccagat ttcaggattg cctttcaaga gcttctgtgc cttcgcaggt      1260
     cttcttcgaa aacctatggg aacggctact ctagcaatag caacggcaga acggactaca      1320
     caggggagcc aaacacttgt cagctggggc aggagagaga acaggaactg ctgtgtgagg      1380
     atcccccagg catggaaggc tttgtgaact gtcaaggtac tgtgcctagc cttagcgttg      1440
     actcccaagg aaggaactgt agtacaaatg actcgccact gtaatacagg ctttctactc      1500
     tctaagaccc ctccttgaca ggacactaac cagactattt aacttgagtg taataacttt      1560
     agaataaaat tgtatagaga tttgcagaag g                                     1591
//