spacer

EBI Dbfetch

ID   AK080202; SV 1; linear; mRNA; HTC; MUS; 954 BP.
XX
AC   AK080202;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male aorta and vein cDNA, RIKEN full-length enriched
DE   library, clone:A530079N22 product:membrane metallo endopeptidase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-954
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 90314e31da1e9b3a672287f06e1c050a.
DR   Ensembl-Gn; ENSMUSG00000027820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029400; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A530079N22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A530079N22"
FT                   /tissue_type="aorta and vein"
FT                   /db_xref="taxon:10090"
FT   CDS             117..>954
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="membrane metallo endopeptidase (MGD|MGI:97004
FT                   GB|NM_008604, evidence: BLASTN, 99%, match=838)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BNU9"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="MGI:MGI:97004"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BNU9"
FT                   /protein_id="BAC37847.1"
FT                   /translation="MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   SNFDILRDELEVILKDVLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPD
FT                   IYGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMEL"
XX
SQ   Sequence 954 BP; 288 A; 189 C; 214 G; 263 T; 0 other;
     ggtttggtga ccgagagcag cgctgccaaa ttgcaccggg gttcatttgg gggctgggaa        60
     ttggccattc cgctgtacag acactgtttt tattttaaaa aacaagattt taggtgatgg       120
     gaagatcaga aagtcagatg gatataactg atatcaatgc tccaaagcca aagaagaaac       180
     agcgatggac tcccctggag atcagcctct ctgtgcttgt cttgctcctg actatcatag       240
     cggtgacaat gatcgctctc tatgcaacct atgatgatgg catttgcaaa tcatcagact       300
     gcataaaatc agctgctcga ctgattcaga atatggatgc ctctgttgag ccatgtacag       360
     acttcttcaa gtatgcttgt ggaggctggt tgaaacgcaa cgtcattccc gagaccagtt       420
     cccgatacag taattttgac attttaagag atgagctaga agtcattttg aaagatgtcc       480
     ttcaagaacc caaaactgaa gacatagtag cagtgcagaa agcaaaaacc ttgtacagat       540
     cgtgtataaa tgagtctgct attgatagca gaggcggaca acctctactc aaactgttac       600
     cagatatata tgggtggcca gtagcatcag ataactggga tcaaacatat ggcacttctt       660
     ggacagctga gaaatccatt gcacaactga attctaaata tgggaaaaag gtcctcatta       720
     atttttttgt tggcactgat gataagaatt ctacccagca tataattcat tttgaccagc       780
     ctcgacttgg cctcccttcc agagactact atgagtgcac tggaatatat aaagaggctt       840
     gcacagcata tgtggatttt atgatttctg tggccagact gattcgtcag gaacaaagtt       900
     tgcctattga tgaaaaccag ctctctttgg aaatgaataa agttatggaa ttgg             954
//


spacer
spacer