spacer

EBI Dbfetch

ID   AK079529; SV 1; linear; mRNA; HTC; MUS; 2959 BP.
XX
AC   AK079529;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male hypothalamus cDNA, RIKEN full-length enriched
DE   library, clone:A230027D20 product:opioid receptor-like, NOCICEPTIN RECEPTOR
DE   (ORPHANIN FQ RECEPTOR) (KAPPA-TYPE 3 OPIOID RECEPTOR) (KOR-3) (ORGC) (K3
DE   OPIATE RECEPTOR) homolog [Mus musculus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2959
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7e63037930e21eead3f2c37090e74b7c.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A230027D20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2959
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A230027D20"
FT                   /tissue_type="hypothalamus"
FT                   /db_xref="taxon:10090"
FT   CDS             221..1324
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="opioid receptor-like, NOCICEPTIN RECEPTOR (ORPHANIN
FT                   FQ RECEPTOR) (KAPPA-TYPE 3 OPIOID RECEPTOR) (KOR-3) (ORGC)
FT                   (K3 OPIATE RECEPTOR) homolog [Mus musculus] (MGD|MGI:97440
FT                   GB|NM_011012, evidence: BLASTN, 100%, match=1330)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542U1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/TrEMBL:Q542U1"
FT                   /protein_id="BAC37672.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   regulatory      2939..2944
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2959
FT                   /note="putative"
XX
SQ   Sequence 2959 BP; 635 A; 749 C; 749 G; 826 T; 0 other;
     gactggctgc tgcgtctagt caatatctta tcttcggagc aggagctagg agccattccc        60
     agccggagca gaccccaagc tagagtgaga agcattactc agttcattgt gctcctgcct       120
     gcctttctgc taagcattag ggtctgtttt ggcccagctt ctgaagaggt tgtgtgtgct       180
     gttggaggaa ctgtactgag tggctttgca gggtgacagc atggagtccc tctttcctgc       240
     cccattctgg gaggtcttgt atggcagcca ctttcaaggg aacctgtctc tcctaaatga       300
     gaccgtaccc catcacctgc tcctcaatgc tagccacagt gccttcctgc cccttggact       360
     caaggtcacc atcgtggggc tctacttggc tgtgtgcatc ggggggctcc tggggaactg       420
     cctcgtcatg tatgtcatcc tcaggcacac caagatgaag actgctacca acatttacat       480
     atttaatctg gcactggctg ataccctggt cttgctgaca ctgcccttcc agggcacaga       540
     catccttctg ggcttctggc catttgggaa tgcactgtgc aagacggtca ttgctatcga       600
     ctactacaac atgtttacca gcactttcac tttgactgcc atgagtgtag accgttatgt       660
     agctatctgc caccctatcc gtgcccttga tgttcggaca tccagtaaag cccaggccgt       720
     taatgtggcc atatgggccc tggcttcggt ggttggtgtt cctgttgcca tcatgggctc       780
     agcacaagtg gaggatgaag agatcgagtg cctggtggag atccccgccc ctcaggacta       840
     ttggggccct gtatttgcca tctgcatctt ccttttttcc ttcatcatcc cggttctgat       900
     catctctgtc tgctacagcc tcatgattcg acgacttcgt ggtgtccggc tgctttcagg       960
     ctcccgagag aaggaccgga acctgcgacg catcacacgg ctggtactgg tagttgtggc      1020
     tgtgtttgtg ggctgctgga cacctgtgca ggtctttgtc ctggttcaag gactgggtgt      1080
     tcagccaggt agtgagactg cagtagccat tctgcgcttc tgcacagccc tgggctatgt      1140
     caacagttgt ctcaatccca ttctctatgc tttcttggat gagaacttca aggcctgctt      1200
     tagaaagttc tgctgtgctt ctgccctgca ccgggagatg caggtttctg atcgtgtgcg      1260
     cagcattgcc aaggatgtag gccttggttg caagacctct gagacagtac cacggccggc      1320
     atgactaggc gtggacctgc ccatggtgcc tgtcagtcca cagagcccat ctacacccaa      1380
     cacggagctc acacaggtca ctgctctcta ggttgaccct gaactgagcg tctggggcct      1440
     tgaatggctt ttcttttggt tcaggatgct cagtcctaga ggaagacctt ttagcaccat      1500
     gggacaggtc aaagcatcaa ggtggcctcc atggcctctg tcagattaag tttcctccct      1560
     ggtataggac cagagagaac caaaggaact gcatggaaac atccacaact cagtggacat      1620
     gcctggtgaa cccatgtagg tattcatggt tcacttgact cttctctggt ttctccctgc      1680
     tgccctggtt ctaggtgggc tcagcctgag gtattgtagt tgtcatgtag tcactattgt      1740
     gactacctgt tgtgtgctat tgccctcagc ctttcagtgt ttgcacagaa ctggtgatca      1800
     tacccagtgt tgcctggccc ttaagcttgg agttgccttg gagcatctag ttctgactcc      1860
     actgatgcat tcagattacc tgaggtgggt gagcatcagt gggttcttgg atgactgttt      1920
     cctgacgatt cttttcatgc agtactatgg agtatatgaa ggggacttca cacttcatct      1980
     ggtactgcca ctgcctgctc taccaacctg gaccaccttc tcagcaagag gctagcaggg      2040
     ggacaagaca caaagcttcc ctaaggctct ttccctccaa aaccactgtg aactcttatt      2100
     ctacagactg tttggcaagc cctgcttcta actgtgtggg aagtaatcag gagaaaattc      2160
     tgtggcctct gtaggctgct cacagcatgg aggcaccaca tgctggtctt gggtatgtgt      2220
     cttggctgct cagtatgggc agggcagggc acgagactat gctctctcct tattctccac      2280
     agcctccctc agctctccag cagtcgctct tttacttgac agtagaggtc agcagttgta      2340
     ctgctagaaa cacacttgta gcccgggaag actggagtca ggatgtgttc tattctatac      2400
     ccacagtgac cacctgcttc atttataggg ttaggacata tccaagcaag gcctgggctt      2460
     ggcatcaaat gaagagctgg tatgagagct gaagcctaaa atggctcatt tgagccaatc      2520
     tgcaaggact attacggttt tggggacatt ggaagaagag tcgatacctt ggagatatat      2580
     tgttggttca cagaagaaga ggctttgtaa atgccctttc tatgggtcag ataaaaaaat      2640
     accagcaacc ttggatagaa tctgatctta cacagagacc ttggttaggt ggtttcatgc      2700
     catgcagaac ccaggctggt tcctgtctca gagagacctg gccttaacaa tctttctggg      2760
     gagaccaggg ttctttcaat gacacttgtg caggagccat tagctctagt gttttcttgc      2820
     taatgctaga aactttgtga atttgtatat ctttatgtat ttaagcatgc aacaaatgtc      2880
     attttcgtgc atgtagctag ccctgaacct gcctctgggg taatgaagga gttctcataa      2940
     taaacactta ccagtgacc                                                   2959
//


spacer
spacer