Dbfetch

ID   AK078967; SV 1; linear; mRNA; HTC; MUS; 1722 BP.
XX
AC   AK078967;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male cecum cDNA, RIKEN full-length enriched library,
DE   clone:9130414H03 product:adipose differentiation related protein, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1722
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f4a690604c479ab7fc61e2aa530fca37.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9130414H03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1722
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9130414H03"
FT                   /tissue_type="cecum"
FT                   /db_xref="taxon:10090"
FT   CDS             157..1395
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adipose differentiation related protein
FT                   (MGD|MGI:87920 GB|NM_007408, evidence: BLASTN, 99%,
FT                   match=1658)"
FT                   /note="putative"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5B5"
FT                   /protein_id="BAC37483.1"
FT                   /translation="MRVANLPLVSSTYDLVSSAYVSTKDQYPYLRSVCEMAEKGVKTVT
FT                   SAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEIVASARGAVTGAKD
FT                   VVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTVLGMVQFMNSGVDN
FT                   AITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLSTKLCSRAYHQALS
FT                   RVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYVSWVEWKRSIGYDD
FT                   TDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQAKHLGVMAGDIYS
FT                   VFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWLVGPFYPQSTEVNK
FT                   ASLKVQQSEVKAQ"
FT   regulatory      1703..1708
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1722
FT                   /note="putative"
XX
SQ   Sequence 1722 BP; 425 A; 429 C; 472 G; 396 T; 0 other;
     gaactagtcg ttgctggccg cttctgctgt gctggtgatg ctggaccgtg ccggagcttg        60
     ctcgtccctc aagctctcct cgttaggcgg tctcttcttc tccacggagg aaaaagatgg       120
     cagcagcagt atgtggatcc gcaacagagc gtggtgatga gagtggccaa cctgcccttg       180
     gtgagctcta cctacgacct tgtgtcctcc gcttatgtca gtacaaagga tcagtacccg       240
     tatttgagat ccgtgtgtga gatggccgag aagggcgtga agaccgtgac ctctgcggcc       300
     atgacaagtg ccctgcccat catccagaag ctggagccac aaattgcggt tgccaatacc       360
     tatgcctgca aggggctaga caggatggag gaaagactgc ctattctgaa ccagccaacg       420
     tccgagattg ttgccagtgc cagaggtgcc gtaactgggg cgaaggatgt ggtgacgact       480
     accatggctg gagccaagga ttctgtagcc agcacagtct caggggtggt ggataagacc       540
     aaaggagcag tgactggcag cgtggaaagg accaagtctg tggtcaatgg cagcatcaat       600
     acagttttgg ggatggtgca gttcatgaac agtggagtag ataatgccat caccaagtcg       660
     gagctgctgg tagaccagta cttccctctc actcaggagg agctggagat ggaagcaaaa       720
     aaggtggaag gatttgatat ggttcagaag ccgagcaact atgaacggct ggagtccctg       780
     tctaccaagc tctgctctcg ggcttatcac caggctctca gcagggttaa agaggccaaa       840
     caaaagagcc aggagaccat ttctcagctc cactccactg tccacctgat tgaattcgcc       900
     aggaagaata tgcacagtgc caaccagaaa attcagggtg ctcaggataa gctctatgtc       960
     tcgtgggtgg agtggaagag aagcatcggc tacgacgaca ccgatgagtc ccactgtgtt      1020
     gagcacatcg agtcacgtac tctggctatc gcccgcaacc tgacccagca gctccagact      1080
     acatgccaga ctgtcctggt caacgcccaa gggttaccac agaacattca agatcaggcc      1140
     aaacacttgg gggtgatggc aggcgacatc tactccgtat tccgcaatgc tgcctccttt      1200
     aaggaagtgt ccgatggcgt cctcacatct agcaaggggc agctgcagaa aatgaaggaa      1260
     tccttagatg aagttatgga ttactttgtt aacaacacgc ctctcaactg gctggtaggt      1320
     cccttttatc ctcagtctac cgaggtgaac aaggccagcc tgaaggtcca gcagtctgag      1380
     gtcaaagctc agtaaacccc tccttgtcac cagagcatga tgttgctggc cagatgaccc      1440
     cttttgctgt attgaaatta acttggtaga tggctttagc ttagaaaagc agcttcttag      1500
     aaccaagggc ctcattatgg tcactcacag ctcagttatg gtcttgcccc agctggccct      1560
     ggcacaggag ttctcttacc tggctggtga gtggcctgtg ttagtcttgt gaggacctcg      1620
     aggaacctaa aagctcagat gcacatacag tcttgtctgt ggcctttgta ttgttattgg      1680
     ctgtaaacgt ctgtctggac cgaataaaga ttcattcacg tg                         1722
//