Dbfetch

ID   AK077922; SV 1; linear; mRNA; HTC; MUS; 1645 BP.
XX
AC   AK077922;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 13 days embryo male testis cDNA, RIKEN full-length enriched
DE   library, clone:6030444M20 product:regulator of G-protein signaling 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1645
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ffe852f6761d5a474fb96b0378b379fe.
DR   Ensembl-Gn; ENSMUSG00000026360; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016548; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016333; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016307; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016411; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016437; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015698; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015975; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000127206; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022966; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021791; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022338; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022306; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021832; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6030444M20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1645
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6030444M20"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             33..668
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signaling 2
FT                   (MGD|MGI:1098271)"
FT                   /db_xref="GOA:O08849"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="MGI:MGI:1098271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08849"
FT                   /protein_id="BAC37065.1"
FT                   /translation="MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT"
FT   regulatory      1621..1626
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1645
FT                   /note="putative"
XX
SQ   Sequence 1645 BP; 510 A; 327 C; 387 G; 421 T; 0 other;
     gaaacagctg cggtggccgc gggagtctga gaatgcaaag tgccatgttc ctggctgtcc        60
     agcacgactg cgtacccatg gacaagagtg caggcaacgg ccccaaggtc gaggagaagc       120
     gggagaaaat gaagcggaca ctcttaaagg attggaagac ccgtttgagc tacttcttgc       180
     agaattcctc tgctcctggg aagcccaaaa ctggcaagaa aagcaaacag caaactttta       240
     tcaagccttc tcctgaggaa gcgcagctct gggcagaagc atttgatgaa ctgctggcca       300
     gtaaatatgg gctggctgca ttcagggcgt ttttaaagtc cgagttctgt gaagaaaaca       360
     ttgaattctg gttggcttgt gaagacttca aaaaaaccaa atcaccccaa aaactgtcct       420
     caaaagcaag gaaaatctat accgacttca tagagaagga agctcccaaa gagataaaca       480
     tagacttcca aacgaaatct ctgattgccc aaaatatcca agaggctaca agtggctgct       540
     tcaccacagc tcagaagagg gtgtacagtt tgatggagaa caattcttat cctcggttct       600
     tggagtccga attctaccag gacttatgta aaaagccaca gatcaccacg gagccccatg       660
     ctacatgaga ccaggagtcc ccccacacac aaaggacatt ccattctgtc tcccaagagc       720
     aaaggctgtg acctgccaga aaaaaaaaaa aaactgacct tgaattcagc ctgagtgtta       780
     ggaaaacatc gctcagaact attgattcaa tgttgggtag tgaatcagga agtcagcaac       840
     ctaggagagg ctctgtgtga gaacggcttc cctcactgtg tgaagaacag agggagggaa       900
     caggcctctg aatgtgttct tcctccttgt cgggaaagca gagtttgaga tgaaagatcc       960
     gatgcaatgt tgttggagca tttaaaatca ataggtctgg gattatgtgg ccttagcaag      1020
     ttggctgtac accttcccta aactagtcca tgttaccaca tagtggtgtt agttctagtt      1080
     ttaatatttt agtactaagt aacattacaa tgtttactgt gtgcaagggt gttgacgttc      1140
     ttaggactac agatcattag tactagtgtg tcacgtatca ctgaaactga gaagtatgtt      1200
     tgagttgtta aatggtgtgt gtgatggacc gaatgctgtg ccgtgctgta gaaccagcgt      1260
     ctgttacgag tgccaaaaac tgtcttgcgg gcagctaaac tttgaagtgg tttttgaata      1320
     cttttaataa atttattttg ctaaataatg tcattgaaca tttggaagtc ccgatgtggt      1380
     tctgttgttt gatttcagta actggaaata tgtcagctat cagagaaaag aactttctag      1440
     caaagaggta tcagtgtgga tcaattgttg tacctgccca ctgagaaatc aacagctgag      1500
     aagtgggaaa tgcttgcttc gaggaagatg ttctccttaa acctatagac attatgtagt      1560
     cttaaaaaca tcagaccaca ttcctagaac cactcattgt gaaagtcaaa tgtgttattt      1620
     aataaaagaa aaagaaaaaa agagc                                            1645
//