spacer

EBI Dbfetch

ID   AK077610; SV 1; linear; mRNA; HTC; MUS; 1948 BP.
XX
AC   AK077610;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 8 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:5730470K18 product:aminolevulinic acid synthase 2,
DE   erythroid, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1948
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c301c87ab5323e83b7915688ec961f5b.
DR   Ensembl-Gn; ENSMUSG00000025270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066337; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5730470K18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1948
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="8 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5730470K18"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             57..1820
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="aminolevulinic acid synthase 2, erythroid
FT                   (MGD|MGI:87990 GB|AK002642, evidence: BLASTN, 99%,
FT                   match=1945)"
FT                   /note="putative"
FT                   /db_xref="GOA:P08680"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015118"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:87990"
FT                   /db_xref="PDB:1H7D"
FT                   /db_xref="PDB:1H7J"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08680"
FT                   /protein_id="BAC36898.1"
FT                   /translation="MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQG
FT                   PTCSQIHLKATKAGGDSPSWAKSHCPFMLSELQDRKSKIVQRAAPEVQEDVKTFKTDLL
FT                   STMDSTTRSHSFPSFQEPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYR
FT                   VFKTVNRWANAYPFAQHFSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAG
FT                   AGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSD
FT                   AGNHASMIQGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPL
FT                   EELCDVAHQYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGY
FT                   IASTRDLVDMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMR
FT                   QLLMDRGFPVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLR
FT                   LAPSPHHSPQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFG
FT                   NMGPQYVTTYA"
FT   polyA_signal    1925..1930
FT                   /note="putative"
FT   polyA_site      1948
FT                   /note="putative"
XX
SQ   Sequence 1948 BP; 447 A; 530 C; 497 G; 474 T; 0 other;
     gcactcaccg tctttggttc gtcctcagtg cagggcaaca ggactttggg ctcaggatgg        60
     tggcagcagc tatgttgcta cggtcctgtc cagtgctctc tcagggcccc acaggcctcc       120
     tgggcaaagt ggctaaaacc taccagttcc tatttagtat tggacgctgc cccatcctgg       180
     ccactcaagg accaacctgt tctcaaatcc atcttaaggc aaccaaggct ggaggagact       240
     ctccatcttg ggctaagagc cattgtcctt tcatgctgtc agaactccaa gacaggaaga       300
     gcaagattgt gcagagggca gctccagaag ttcaagagga tgtcaagact ttcaagacag       360
     acctgctgag caccatggat tcaaccaccc gaagccattc atttcctagt ttccaggagc       420
     cagagcagac tgaaggggca gttccccacc tgattcagaa caatatgact ggaagccagg       480
     ctttcggtta tgaccaattt ttcagagaca agatcatgga gaagaaacag gaccacacct       540
     accgtgtgtt caagactgtg aatcgttggg ctaatgccta cccctttgcc caacacttct       600
     ccgaggcatc tatggcatca aaggatgttt ctgtttggtg tagtaatgac tatttgggca       660
     taagcagaca ccctcgtgtc ttgcaggcca tagaggagac cctgaagaat catggagctg       720
     gagctggggg cactcgcaat atctcaggta ccagcaagtt tcatgtggag cttgaacagg       780
     agctggctga actacaccag aaagactcag ctctgctctt ctcctcctgt tttgtggcca       840
     atgattctac tctctttaca ctggccaagc ttctgccagg gtgtgagatc tactcagatg       900
     caggcaatca tgcctccatg atccaaggca ttcgcaacag tggtgcagcc aagtttgtct       960
     tcagacacaa tgacccaggc cacctgaaga aacttctcga gaagtctgat cccaagacac      1020
     caaaaattgt ggcttttgag actgttcatt ccatggatgg tgccatctgt cctctggagg      1080
     aattgtgtga tgtggcccac cagtatggag ccctgacctt cgtagatgaa gtccatgctg      1140
     taggactgta tggggcccgg ggtgcaggta tcggggagcg tgatggaatt atgcacaagc      1200
     ttgacatcat ctctggaact cttggcaagg cctttggttg cgtcggtggc tatatagcca      1260
     gcactcggga cttggtggac atggtgcgct cctacgctgc aggcttcatc tttaccactt      1320
     cactgcctcc catggtgctc tctggggctc tagaatctgt gcgcctactc aagggagagg      1380
     agggtcaagc cctgaggcgg gcacaccagc gcaatgtcaa acacatgcgc cagctgctaa      1440
     tggacagggg ctttcctgtt atcccctgtc ccagccacat catccccatc agggtgggta      1500
     atgcagcact caacagcaag atctgtgatc ttctgctctc caagcacagc atctatgtgc      1560
     aggccatcaa ctacccaact gtgcctcgtg gtgaggagct actgcgcttg gccccctccc      1620
     cccaccacag ccctcagatg atggaaaact ttgtggagaa gctgctgctg gcctggactg      1680
     aggtggggct gcccctccaa gatgtgtctg tggctgcatg caacttctgt catcgtcctg      1740
     tgcactttga acttatgagc gagtgggagc gatcctactt tgggaacatg ggaccccaat      1800
     atgttaccac ctatgcttaa ggagccagct gccttggatg ccagctccac ctgcactccc      1860
     cctggggctg ggcttcctcc tgctctctgc tttcctgtgt gcttctggct gacttgattc      1920
     tgaaaataaa gagcaacttg aaacattc                                         1948
//


spacer
spacer