spacer

EBI Dbfetch

ID   AK077302; SV 1; linear; mRNA; HTC; MUS; 2034 BP.
XX
AC   AK077302;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male xiphoid cartilage cDNA, RIKEN full-length enriched
DE   library, clone:5230401N02 product:epidermal growth factor-containing
DE   fibulin-like extracellular matrix protein 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2034
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8b9fa4d2d1ef6d23667881ce62f45dcf.
DR   Ensembl-Gn; ENSMUSG00000020467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020759; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5230401N02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2034
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5230401N02"
FT                   /tissue_type="xiphoid cartilage"
FT                   /db_xref="taxon:10090"
FT   CDS             132..1613
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 1 (MGD|MGI:1339998
FT                   GB|AI156278, evidence: BLASTN, 99%, match=454)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BPB5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="MGI:MGI:1339998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BPB5"
FT                   /protein_id="BAC36738.1"
FT                   /translation="MLQTLFLTMLTLALVKSQYTEETITYTQCTDGYEWDPIRQQCKDI
FT                   DECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEHPQQETPAAEASSGATTGTVAA
FT                   RSMATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGY
FT                   EQSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPP
FT                   YCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQ
FT                   GYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYEVVRSRTCQDINECET
FT                   TNECREDEMCWNYHGGFRCYPRNPCQDHYVLTSENRCVCPVSNTMCRELPQSIVYKYMS
FT                   IRSDRSVPSDIFQIQATMIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGP
FT                   REYIVDLEMLTVSSIGTFRTSSVLRLTIIVGPFSF"
FT   polyA_signal    2008..2013
FT                   /note="putative"
FT   polyA_site      2034
FT                   /note="putative"
XX
SQ   Sequence 2034 BP; 602 A; 471 C; 443 G; 518 T; 0 other;
     gctttttcct cctcctgtgg ctgctgctgc agccagacct cgccagttca gacctaccag        60
     gctgccctcc cctacgcact ccttcgctgc ccgggcagga aagttgcgcg gcccccccgc       120
     agagaatcac gatgttgcaa acacttttcc taactatgct gactctggcg ctggtcaagt       180
     cacagtacac cgaggaaacc atcacataca cgcaatgcac cgatggatat gaatgggacc       240
     ccataagaca gcagtgtaaa gatattgatg aatgtgacat tgtcccagat gcttgcaaag       300
     gtggaatgaa atgtgtcaac cactatggag gatatctctg ccttcctaaa acagcccaaa       360
     ttattgtcaa taatgagcat cctcagcaag aaacaccagc tgcagaagct tcgtcaggtg       420
     ccaccactgg gactgtagct gccaggagca tggcaaccag tggtgtggtg cctgggggtg       480
     gcttcatggc cagtgctact gcagttgctg gccctgaagt tcaaactggc cgaaataact       540
     ttgtcatccg aagaaaccca gctgaccctc agcgcatccc ttccaaccct tcccaccgga       600
     tccagtgtgc agcaggctat gaacagagtg agcataatgt gtgccaagat attgatgagt       660
     gcacctcagg gactcacaat tgtagaacgg accaagtatg catcaattta cgaggttcct       720
     tcacatgtca gtgtcttcct gggtatcaga agcgaggtga acagtgtgtg gatatagatg       780
     aatgcacagt gcctccatat tgccaccaaa gatgtgttaa cacacctggt tccttctact       840
     gccagtgcag tccagggttt cagctggcag caaacaacta cacttgtgtg gatataaatg       900
     aatgtgatgc cagcaaccag tgtgctcaac aatgctacaa cattcttggc tcattcatct       960
     gtcagtgtaa tcaaggatat gaactaagca gtgacagact caactgtgaa gacatcgacg      1020
     aatgcagaac ctcaagctac ctatgccaat atcaatgtgt caatgaacct gggaagttct      1080
     catgtatgtg cccacagggt tacgaagtgg tgcgcagcag aacctgtcag gatataaatg      1140
     aatgtgagac caccaatgaa tgccgagaag atgagatgtg ctggaattac catgggggct      1200
     tccgctgtta cccacgaaac ccatgtcaag atcactatgt tctaacatca gaaaaccgat      1260
     gtgtttgccc agtctcaaac actatgtgcc gggagctgcc ccagtccatt gtctacaaat      1320
     acatgagcat ccgatctgac aggtccgtgc cttcagacat cttccagata caggcaacaa      1380
     tgatttatgc aaacaccatt aatacttttc ggattaaatc tggaaatgaa aatggagagt      1440
     tctacctacg acaaacaagc cctgtgagtg caatgctggt gcttgtgaag tctctatcag      1500
     gaccaagaga atacatcgtg gacctggaga tgctgacagt cagtagtata ggaaccttcc      1560
     gcacaagctc tgtgttaaga ttgacaataa tagtggggcc attttcattt tagcctttta      1620
     ctcatataaa gcctactaca agcatttaaa tcagccaaac aatatcatta ccttaaaact      1680
     ctattttatt tatagctata tctagtacat gtatattcaa atagctagac tatggtaaga      1740
     agtgggcatt taatccataa gagtcaatgt ttatcgttat cactgtgtgt aaattagacc      1800
     tttatccaac attaagagag ctaatcatat attatctagt gaaacttgga ttctttcctg      1860
     caaaatggga ccaagcaagg atactgttct gtgttgtata gagaaatata cacctccaca      1920
     gaccatcccg tgagaattgg ccatcttagc atgaagatca agaaggaggg tttttttaac      1980
     tgctttgtaa gaaaatggaa aaaagtcaat aaagatatat ttctttagaa aatg            2034
//


spacer
spacer