Dbfetch

ID   AK077256; SV 1; linear; mRNA; HTC; MUS; 1661 BP.
XX
AC   AK077256;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 11 days pregnant adult female ovary and uterus cDNA, RIKEN
DE   full-length enriched library, clone:5031429D02 product:caspase 12, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1661
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2882832d7dc824c81e2538efd9a1d41e.
DR   Ensembl-Gn; ENSMUSG00000025887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027009; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5031429D02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1661
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="11 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5031429D02"
FT                   /tissue_type="ovary and uterus"
FT                   /db_xref="taxon:10090"
FT   CDS             46..1305
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="caspase 12 (MGD|MGI:1312922)"
FT                   /note="putative"
FT                   /db_xref="GOA:O08736"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR017350"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR033139"
FT                   /db_xref="MGI:MGI:1312922"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08736"
FT                   /protein_id="BAC36712.1"
FT                   /translation="MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIG
FT                   ESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSS
FT                   PSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAK
FT                   EIYPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQ
FT                   EMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNS
FT                   NCRSLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVET
FT                   DFIAFKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELT
FT                   QMPTIERVSMTRYFYLFPGN"
FT   regulatory      1643..1648
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1661
FT                   /note="putative"
XX
SQ   Sequence 1661 BP; 537 A; 308 C; 356 G; 460 T; 0 other;
     gttttcggtt ttgatgcttt ttatgtccag gagtcctgca cagccatggc ggccaggagg        60
     acacatgaaa gagatccaat ctacaagatc aaaggtttgg ccaaggacat gctggatggg       120
     gtttttgatg acctggtgga gaagaatgtt ttaaatggag atgagttact caaaataggg       180
     gaaagtgcga gtttcatcct gaacaaggct gagaatctgg ttgagaactt cttagagaaa       240
     acagacatgg caggaaaaat atttgctggc cacattgcca attcccagga acagctgagt       300
     ttacaatttt ctaatgatga ggatgatgga cctcagaaga tatgtacacc ttcttctcca       360
     tcagaatcca agagaaaagt agaggatgat gaaatggagg taaatgctgg attggcccat       420
     gaatcacatc taatgctgac agctcctcat ggactccaga gctcagaagt ccaagataca       480
     ctgaagcttt gtccacgtga tcagttttgt aagataaaga cagaaagggc aaaagagata       540
     tatccagtga tggagaagga gggacgaaca cgtctggctc tcatcatctg caacaaaaag       600
     tttgactacc tttttgatag agataatgct gatactgaca ttttgaacat gcaagaacta       660
     cttgaaaatc ttggatactc tgtggtgtta aaggaaaacc ttacagctca ggaaatggag       720
     acagagttaa tgcagtttgc tggccgtcca gagcaccagt cctcagacag cacattcctg       780
     gtgtttatgt cccatggcat cctggaagga atctgtgggg tgaagcaccg aaacaaaaag       840
     ccagatgttc ttcatgatga cactatcttc aaaattttca acaactctaa ctgtcggagt       900
     ctgagaaaca aacccaagat tctcatcatg caggcctgca gaggcagata taatggaact       960
     atttgggtat ccacaaacaa agggatagcc actgctgata cagatgagga acgtgtgttg      1020
     agctgtaaat ggaataatag tataacaaag gcccatgtgg agacagattt cattgctttc      1080
     aaatcttcta ccccacataa tatttcttgg aaggtaggca agactggttc cctcttcatt      1140
     tccaaactca ttgactgctt caaaaagtac tgttggtgtt atcatttgga ggaaattttt      1200
     cgaaaggttc aacactcatt tgaggtccca ggtgaactga cccagatgcc cactattgag      1260
     agagtatcca tgacacgcta tttctacctt tttcccggga attagcacag gcaactctca      1320
     tgcagttccc agtcaagtat tgctgtagct gagaagaaaa gaaaattcca agatcccagg      1380
     atttttaaat gtgtaaaact tttcagttag atattttata caatatcata aggctagata      1440
     atttccatag gttattttta ggggaaacct gatacgtaaa attttgcatg aaaagtatag      1500
     attcgttcct tccttccaaa tctgctcatc ttttacttta ttttattaaa tttatatttg      1560
     cacatttttg taaaatgaat aaaggaaaaa gacactaaag aacatgtctg aacatatcct      1620
     ggaacttctt ctttgtaaaa tgaataaagg aaaaagacac t                          1661
//