Dbfetch

ID   AK077192; SV 1; linear; mRNA; HTC; MUS; 1669 BP.
XX
AC   AK077192;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4933425M12 product:lipoic acid synthetase, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1669
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 974b974b29b33b64969b603c718f1d31.
DR   Ensembl-Gn; ENSMUSG00000029199; mus_musculus.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029246; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029392; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028409; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000122026; mus_musculus.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072019; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071426; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071564; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071490; mus_musculus_pwkphj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4933425M12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1669
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4933425M12"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             134..1255
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lipoic acid synthetase (MGD|MGI:1934604
FT                   GB|NM_024471, evidence: BLASTN, 100%, match=1356)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q99M04"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="MGI:MGI:1934604"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M04"
FT                   /protein_id="BAC36672.1"
FT                   /translation="MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQ
FT                   DFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTV
FT                   CEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTA
FT                   KAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAV
FT                   EKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGL
FT                   GETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFL
FT                   YTASGPLVRSSYKAGEFFLKNLVARRKTKASKV"
XX
SQ   Sequence 1669 BP; 481 A; 346 C; 440 G; 402 T; 0 other;
     ggagctagtc gagtcgcgcc ggtcggcgac gacgtatcgc gtcatgactc aagcgacgag        60
     ttgttggacg cgtccggtgc cgggggtgct gttccctcga tcccttgaca ctcctgagac       120
     ctaaaagagg gggatggctc tacgctgctg ggatacagct cgcagcctgg ggtcccggat       180
     atttggaaga tatgcgttca cggttagagc attaagttct ttgccagata agaaaaagga       240
     atttttgcat aatggaccag accttcaaga ttttgtatct ggtgatcttg cagacaagag       300
     tacatgggat gaatataaag gaaacttaaa gcgccagaaa ggagaaaggc taagactacc       360
     tccatggcta aagacaaaga tacccatggg taaaaactac aataaactga aaaatacatt       420
     gcggaattta agtctccaca cagtgtgtga ggaagcccgg tgccccaaca ttggagagtg       480
     ttggggaggt ggggaatatg ccacagccac agccacgatc atgttgatgg gggacacatg       540
     cacaagaggt tgcagatttt gttccgttaa gaccgcaaga aatccccctc cattggatgc       600
     caatgagccc gacaatacgg ccaaagcaat tgcagagtgg ggtctggatt atgttgtcct       660
     gacgtcggtg gatcgagatg atgtggccga cgggggagct gagcacatcg ccaagaccgt       720
     gtcatgcttg aaggaaagga atccaaaaat cctcgtggaa tgcctcaccc cagacttccg       780
     aggtgatctg agagcagtgg agaaggtggc tctgtctgga ttagatgtgt atgcacacaa       840
     tgtggagact gtccccgagt tacagaggaa agttcgtgat ccccgggcca attttgacca       900
     gtctcttcgt gtactgagac atgccaagga ggtccagcct gatgttgttt ccaaaacatc       960
     gataatgctg ggccttggtg agacagacga gcaagtctat gccacactga aagctctccg      1020
     tgcggccgac gtggactgtt taactctagg gcagtacatg cagccaacga agcgccacct      1080
     taaggttgaa gaatatgtta ctcctgagaa gttcaaatac tgggaaaaag tagggaatga      1140
     acttggattt ctctatacgg caagtggtcc tttggtgcga tcttcatata aagcaggtga      1200
     atttttcctg aaaaatctag tggctagaag aaaaacaaaa gcttctaaag tgtagccaag      1260
     cccttcaaga tcacaggagt gttgcgattt tgcttccagt tggtgtgagg atggtgtcac      1320
     cctgtcagga ttcctgtgag tgcaaggcag caccgttctg aagggtctga tggctgatcg      1380
     aagcggaatg gtgtatacct gtaattccac ccaggaaaaa aaaaaggaaa agaaaaagag      1440
     aaaagaagaa agaaaagaag cctataaccc tgtaaacgac acacatttag tgataattca      1500
     tggacttctt gctggccttt gtcctcatcc ttgtcagtga tgacttgatc acagaacagc      1560
     ttggaacggc ttgctgttgc cattgtaatt caagtctatg aacatttaga agatcttata      1620
     aattacagta acccatgtga aatttctttt cttaaaaaga tttatttct                  1669
//