spacer

EBI Dbfetch

ID   AK076187; SV 1; linear; mRNA; HTC; MUS; 899 BP.
XX
AC   AK076187;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 18 days pregnant adult female placenta and extra embryonic
DE   tissue cDNA, RIKEN full-length enriched library, clone:3830418K20
DE   product:apolipoprotein A-I, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-899
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000032083; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034588; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3830418K20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..899
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="18 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3830418K20"
FT                   /tissue_type="placenta and extra embryonic tissue"
FT                   /db_xref="taxon:10090"
FT   CDS             50..844
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="apolipoprotein A-I (MGD|MGI:88049 GB|NM_009692,
FT                   evidence: BLASTN, 99%, match=896)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q00623"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="MGI:MGI:88049"
FT                   /db_xref="PDB:2LEM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00623"
FT                   /protein_id="BAC36241.1"
FT                   /translation="MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAV
FT                   KDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDW
FT                   VRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGR
FT                   LSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLK
FT                   TLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ"
XX
SQ   Sequence 899 BP; 227 A; 253 C; 264 G; 155 T; 0 other;
     tgacccagac tgtcggagag ctccggggag gtcacccaca cccttcagga tgaaagctgt        60
     ggtgctggcc gtggctctgg tcttcctgac agggagccag gcttggcacg tatggcagca       120
     agatgaaccc cagtcccaat gggacaaagt gaaggatttc gctaatgtgt atgtggatgc       180
     ggtcaaagac agcggcagag actatgtgtc ccagtttgaa tcctcctcct tgggccaaca       240
     gctgaacctg aatctcctgg aaaactggga cactctgggt tcaaccgtta gtcagctgca       300
     ggaacggctg ggcccattga ctcgggactt ctgggataac ctggagaaag aaacagattg       360
     ggtgagacag gagatgaaca aggacctaga ggaagtgaaa cagaaggtgc agccctacct       420
     ggacgaattc cagaagaaat ggaaagagga tgtggagctc taccgccaga aggtggcgcc       480
     tctgggcgcc gagctgcagg agagcgcgcg ccagaagctg caggagctgc aagggagact       540
     gtcccctgtg gctgaggaat ttcgcgaccg catgcgcaca cacgtagact ctctgcgcac       600
     acagctagcg ccccacagcg aacagatgcg cgagagcctg gcccagcgcc tggctgagct       660
     caagagcaac cctaccttga acgagtacca caccagggcc aaaacccacc tgaagacact       720
     tggcgagaaa gccagacctg cgctggagga cctgcgccat agtctgatgc ccatgctgga       780
     gacgcttaag acccaagtcc agagtgtgat cgacaaggcc agcgagactc tgactgccca       840
     gtgaggtgcc cgcttccact ccccaccccc gcattggctt tcttacaata aacctttcc        899
//


spacer
spacer