Dbfetch

ID   AK075861; SV 1; linear; mRNA; HTC; MUS; 1385 BP.
XX
AC   AK075861;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male tongue cDNA, RIKEN full-length enriched library,
DE   clone:2310003L23 product:SIR2L3 isoform B (Sir2L3) mRNA, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1385
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 14021a073d0ce63b9eae176b6d000492.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2310003L23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1385
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2310003L23"
FT                   /tissue_type="tongue"
FT                   /db_xref="taxon:10090"
FT   CDS             224..997
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SIR2L3 isoform B (Sir2L3) mRNA (GB|AF299339,
FT                   evidence: BLASTN, 99%, match=1384)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8R104"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R104"
FT                   /protein_id="BAC36012.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
FT   regulatory      1372..1377
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1385
FT                   /note="putative"
XX
SQ   Sequence 1385 BP; 298 A; 367 C; 401 G; 319 T; 0 other;
     gaggcgccgt cgtcctgcag agcatcatgg cgctaagcgg tcgactggca ttggccgcgc        60
     tcagactgtg gggtccggga gtgttacagg tgggagaagg cccatatccc tctgtgtggg       120
     agcctcaggc ggctttggag gtggaggaag cagtgagaag aagttttctc tgcaggatgt       180
     agctgagctg cttcggacca gagcctgcag tagggtggtg gtcatggtgg gggccggcat       240
     cagcacaccc agtggcatcc cggacttcag atccccaggg agcggcctct acagcaacct       300
     tcagcagtat gacatcccgt accctgaagc catctttgaa cttggctttt tctttcacaa       360
     ccccaagccc tttttcatgt tggccaagga gctgtaccct gggcactaca ggcccaatgt       420
     cactcactac ttcctgaggc tcctccacga caaggagctg cttctgcggc tctatacaca       480
     gaacatcgac gggcttgaga gagcatctgg gatccctgcc tcaaagctgg ttgaagccca       540
     cgggaccttt gtaacagcta catgcacggt ctgtcgaagg tccttcccag gggaagacat       600
     atgggctgat gtgatggcgg acagggtgcc ccgctgccct gtctgtactg gcgttgtgaa       660
     acccgacatt gtgttctttg gggagcagct gcctgcaagg ttcctactcc atatggctga       720
     cttcgctttg gcagatctgc tactcattct tgggacctcc ctggaggtgg agccttttgc       780
     cagcttgtct gaagcagtac agaaatcagt gccccgactg ctcatcaatc gagacttggt       840
     ggggccgttc gttctgagtc ctcgaaggaa agatgtggtc cagctagggg atgtagttca       900
     tggtgtggaa aggctggtgg acctcctggg gtggacacaa gaactgctgg atcttatgca       960
     gcgggaacgt ggcaagctgg atggacagga cagataagac tatggcttct tcacctgggg      1020
     aagtcacaca gcagatcatc ctatgtccag caagacttca tgcctgaaga cagctccaac      1080
     acgtttacaa acatgaacca gaccacaaca tgtggcctgg acagtggtcc tccgaggctg      1140
     cctttggaaa ggctgaccag ggatgtctac ccttggggcc cctccatgtg tgcgccctgt      1200
     ccacctcatc actgctgaag gtgtagtgca ggtgctgctt tctgcagcgg cccttaagtt      1260
     atcacgaggg cagcacagca cgcccgtcgc caggcaggcg atgcactagg gcaatctagc      1320
     atgttgatcg gtaaagtggc atctttaact acaacatcat ttcttgcatg aaataaactt      1380
     agtat                                                                  1385
//