Dbfetch

ID   AK075736; SV 1; linear; mRNA; HTC; MUS; 2459 BP.
XX
AC   AK075736;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male cerebellum cDNA, RIKEN full-length enriched
DE   library, clone:1500034G16 product:lectin, galactose binding, soluble 8,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2459
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; be0b2042f0269cda1e0b279e48f91d7e.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143693; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1500034G16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2459
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1500034G16"
FT                   /tissue_type="cerebellum"
FT                   /db_xref="taxon:10090"
FT   CDS             360..1031
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lectin, galactose binding, soluble 8
FT                   (MGD|MGI:1928481 GB|NM_018886, evidence: BLASTN, 100%,
FT                   match=841)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8C6H0"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR030638"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C6H0"
FT                   /protein_id="BAC35918.1"
FT                   /translation="MPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVG
FT                   IYGKVNIHSIGFRFSSDLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPG
FT                   RTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLNVKAFVRNSFLQDAWGEEERNIT
FT                   CFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRS
FT                   W"
FT   regulatory      2437..2442
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2459
FT                   /note="putative"
XX
SQ   Sequence 2459 BP; 722 A; 521 C; 557 G; 659 T; 0 other;
     gggctccggg aaccggacgg cgtccgtcag gggacacaag tcggagcaaa gcgcttacta        60
     ccaccgggga caagttttta ctttgagtaa tccttaaatg aagagtgggt aaagtgtgta       120
     tacggaagag agactccaat caacaatatc aataagttga aaaagaaaaa tgttgtcctt       180
     aaataaccta caaaatatca tctataaccc gattccaggt tgactttcag ctgggcaaca       240
     gcctgaagcc aagagcagac gtggccttcc actttaaccc tcggttcaaa aggtctagct       300
     gcattgtttg taacacactg acacaggaga agtggggctg ggaggagatc acctacgaca       360
     tgcccttcag aaaagaaaag tcctttgaga tcgtgttcat ggtgctcaag aacaaattcc       420
     aggtggctgt gaacggaagg catgttctgc tgtacgccca caggatcagc ccggagcaga       480
     tcgacacagt gggcatctac ggcaaagtga acatccactc catcgggttc agattcagct       540
     cggatttaca gagtatggaa acatctgctc tgggactgac acagataaac agagagaata       600
     tacaaaagcc aggcaagctc cagctgagcc tgccatttga agcaaggttg aatgcctcca       660
     tgggtcctgg acgaaccgtt gtcattaaag gggaagtgaa caccaatgcc cgaagcttta       720
     atgttgacct agtggcagga aaaacaaggg atatcgctct gcacttgaac ccacgcctca       780
     atgtgaaagc atttgtaaga aattcctttc ttcaggatgc ctggggagaa gaggagagaa       840
     atattacctg cttcccattt agttctggga tgtactttga gatgataatc tactgtgatg       900
     tccgggaatt caaggttgct ataaatggtg tgcacagcct ggagtacaaa cacagattta       960
     aagacctaag cagtattgat acactatcag tcgatggtga tatccgtttg ctggatgtaa      1020
     ggagctggta gctaccatga ctgccaaaac ccccgaaata caaaatggct tatccggtac      1080
     tggccatgtc aaatgcatct cgctttcacc atattgttta tattgctaag ttgagctcct      1140
     ccaacatcaa gtcctactgg tgttgtcagg tctggccatg cagtacattc agaggaacag      1200
     agccggggca atcacagctc actgccagag aggctctgca cactgggtcc ctcttataaa      1260
     ccacactcag caaatattta agtgcctaat atactacata tactagctaa tagggatggc      1320
     aagcatactt cctttgtata ttctctgagc cgggcacaga catggcaggg cccagaactt      1380
     gtgtggtcca tgttttctag cacttcgtac cagtttctgg cctcctaatg tagggtcttc      1440
     ttgctggcat tgcattaacc ccactagggg cctttgcagt taaggtcaga aaaatatact      1500
     aatggatggc aaacactact tccccagcaa cccttttcat aatcagcatt cctatcatat      1560
     ctcataattg aagactgcat agcatttact tagctctcac cgctttaaac tttataaaat      1620
     gtatgatgct gaacacagca gaaaaactga ggccaaaacc ctgaattatg acaaaacaag      1680
     tgttctgctc caagcagatt ttggtggttg attggcgctc aagtccaggg tgtgtgggta      1740
     cctgtggcaa agtaaggcag aagttggata aaccgtgtgt gtaaaaccct cttggacgta      1800
     tatataaaac aagcactatc aaagcaaacc caggggcgta gtgtgaaagg cttagttggt      1860
     gtggagacta gccctcgtgc ctttgggtct gaagatgtcg gtctgcagca gcagcgaggt      1920
     caggcacatt aaaccacagg acagaattct gctggggttt aggagtattc agccaatctg      1980
     cttagatata tgcacttgtg catatgaaat aataccatca gcagtcttac tcaaggcagc      2040
     aactgctagt ccttcatttt catgcaaatt tattatgttc actcttcaat atggggtggt      2100
     gggtggaact gggtaatttg tacggaggcc aggaggctct agaattctcc agagttatgt      2160
     cttcataaag aatgagtctt cataaagaat gcactactga gatattgggg gctcaaaggc      2220
     actcaggaaa aaaaaataaa agcctattca tacaacagct tattttcatt tctattttta      2280
     cacaattaag actgattcta agtagattca gtcttaagtt cttagatttt ttttttttaa      2340
     aaagctgctg gaatttaggt tgtgagacct tctgttgtat attccgaaat tctatctcta      2400
     aactgcaaaa tgcctttttg cttgtcctaa ttctgcatta aagttttata ttaaattgc       2459
//