Dbfetch

ID   AK075704; SV 1; linear; mRNA; HTC; MUS; 2370 BP.
XX
AC   AK075704;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male lung cDNA, RIKEN full-length enriched library,
DE   clone:1200005K12 product:Lutheran blood group (Auberger b antigen
DE   included), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2370
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 537cb9a20dd2f529ecb103122bee49d2.
DR   Ensembl-Gn; ENSMUSG00000002980; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031795; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031776; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031498; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032242; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030841; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031615; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031567; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031698; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031603; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032270; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030565; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030941; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003061; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082064; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0082141; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0082079; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082086; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081697; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082564; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082218; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0081638; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0081797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0081673; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0081832; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081696; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082834; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081644; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080747; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1200005K12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2370
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1200005K12"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             28..1896
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Lutheran blood group (Auberger b antigen included)
FT                   (MGD|MGI:1929940 GB|NM_020486, evidence: BLASTN, 99%,
FT                   match=2349)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9R069"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1929940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R069"
FT                   /protein_id="BAC35900.1"
FT                   /translation="MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVAL
FT                   DCTPREHPEHYVLEWFLVDGTGARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLV
FT                   IAKVQVGDGRDYVCVVKAGAAGTSEATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIA
FT                   TCSSNNGNPVPRITWYRNGQRLEVPMEVNQKGYITIRTVREASGLYSLTSTLYLRLHKD
FT                   DRDANFHCAAHYDLPSGQHGRLDSHTFRLTLHYPTEHVEFWVGSPSTTEGWVREGDAVQ
FT                   LLCQGDGSPSPEYSFFRQQGTQEEQLNVNLKGNLTLERVHRNQSGIYGCRVEDYDADEE
FT                   VQLVKKLKLHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVRWTKDSVTLAD
FT                   GPMLSLQSVTFDSAGTYTCEASTPTVPLLSRTQSFQLIVQGAPELKPNEIMPKSGNSWT
FT                   EGDEVMLTCSARGFPEPKLTWSQRGDTPAEPPFEGRGWKSSSLMVKVTSALSREGVSCE
FT                   ASNIHGKKGHVFHFGSVAPQTAQAGVAVMAVAVSVGLLLLVVAAFYCMRRKGRPGCCRR
FT                   AEKGAPPAREPELSHSGSERPEHTGLLMGGPSGGGRGGSGGFGDEC"
FT   regulatory      2349..2354
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2370
FT                   /note="putative"
XX
SQ   Sequence 2370 BP; 476 A; 720 C; 713 G; 460 T; 1 other;
     gaagttcntg ccgccactgc agggaacatg gaaccccctg acgcccgcgc agggctgctg        60
     tggctcacct tcctgctgtc gggctactca ggtgcccagg ctgagctgca cgtgtccgtg       120
     cccccacggg tggaggtgat gcgaggcgag caagtcgccc tggactgcac tccacgggag       180
     caccctgagc attacgtgct ggaatggttc ctcgttgatg gtactggggc tcgacaccgt       240
     ctggcttctg tggaaccaca gggctcagag ttcctgggca cagtccactc tctgggccgc       300
     gtacccccat acgaggtaga ctctcgtggg cgcctggtga tagcaaaggt ccaggtgggc       360
     gatggacggg actacgtgtg cgtagtgaag gctggggcag cgggtacctc agaggccacc       420
     tcaagtgtcc gtgtgtttgc aacaccagag gatacggagg tgtctcccaa caaagggacg       480
     ctgtctgtga tggaccagtt tgcccaggag attgccacct gcagcagcaa caacggaaac       540
     cccgtgcctc ggatcacatg gtaccgaaac gggcagcgtc tggaagtacc catggaggtg       600
     aaccaaaagg gctacataac catccgtact gtccgggaag cctcaggcct gtactccctg       660
     accagcaccc tctacctgag gctgcacaag gatgatcggg atgccaactt ccactgtgct       720
     gctcactacg acttgccctc aggccaacat ggccgcctgg acagccatac ctttcgcctc       780
     accctgcact atcccacgga acatgtagaa ttctgggtgg ggagcccgtc caccacggag       840
     ggctgggtcc gtgagggtga tgctgtccag ctgctctgcc agggcgatgg cagccccagc       900
     ccagagtatt cttttttccg ccagcagggt acccaggagg aacagctgaa tgtcaacctc       960
     aagggaaact tgaccctaga acgggtgcat cggaaccaga gcgggatcta cggctgcaga      1020
     gtggaggatt acgatgccga cgaggaagtg caacttgtca agaagctaaa gctgcacgtg      1080
     gcctacctgg atccattgga gctgagcgtg cctgaggagc tcttcgtatt cctgaacagc      1140
     agcagcacgg tggtgaactg ctccgctaga ggcctgccta ctcctactgt gcgatggacc      1200
     aaggattctg tgacccttgc agacggcccc atgctctctc tccagtctgt gacctttgac      1260
     tcagctggca cctatacctg tgaggcgtcc acacccacag tccccctcct gagccgcaca      1320
     cagagtttcc agctcatcgt ccaaggagca ccagagttaa aaccgaatga gataatgccc      1380
     aaatcaggga atagctggac agaaggcgat gaagtcatgc tgacctgctc cgcccggggc      1440
     ttcccagagc ccaaactcac ctggagtcag cgaggcgata ctccagcaga gccgcccttt      1500
     gagggtagag gctggaagag cagctcgctg atggtgaaag tgaccagcgc cctgagccga      1560
     gagggcgtgt cctgtgaagc gtctaacatc catggcaaga aaggccatgt cttccacttt      1620
     ggctctgtgg cccctcagac tgcccaggct ggagtggctg tcatggctgt agctgtcagc      1680
     gtcggtcttt tgctactcgt ggtcgctgct ttctattgca tgagacgcaa agggcgccct      1740
     ggctgctgcc ggcgagcaga gaaaggggcg ccgccagcca gggaaccgga gttgagccac      1800
     tctgggtcag agcggccaga acacacgggc cttctcatgg gtgggccctc cggaggaggc      1860
     agaggtggca gtggaggctt tggagatgag tgttgaggct gacgacctcc cagaggcaat      1920
     ctctggatct ggaactttgg gcatcatcgg aggaccggct ctgagcacgc ctccgcctca      1980
     gcgcacgcct ctgcctcctt ccttctccag cctcggccct cccttccttc ctctgcctgc      2040
     tgggcaggga cccacagtgg ccagcggcct tggggaggga aagagggagg tgggggctgg      2100
     gagggggcct tcctccaggg aatgtaactc tcccaggccc cagaatagct cctggatcca      2160
     agcccggggc ccggcctggg acacggcgct gagggtcggc aggctggggc tatttttacc      2220
     tcctgactcc cttgctgggc actacccccc cacctgatac cctgctgtgt agtctgacac      2280
     tggagtcccc aacccacccc attcctgccc tcatcctcag cccatcattt gtgaacactg      2340
     gactctgaaa taaatgctgc ctgtcacgtg                                       2370
//