Dbfetch

ID   AK075585; SV 1; linear; mRNA; HTC; MUS; 1543 BP.
XX
AC   AK075585;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male kidney cDNA, RIKEN full-length enriched library,
DE   clone:0610011K11 product:epidermal growth factor-containing fibulin-like
DE   extracellular matrix protein 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1543
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 87e14f13a8676806f1f08d453c893e0e.
DR   Ensembl-Gn; ENSMUSG00000024909; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024710; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024676; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024649; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024676; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024444; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025123; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024416; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024510; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024629; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024540; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025171; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023662; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023978; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000165485; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050571; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050552; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050505; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050500; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050244; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050997; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050377; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050276; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050243; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050401; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050241; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051109; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049971; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049540; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=0610011K11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1543
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="0610011K11"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             82..1413
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2 (MGD|MGI:1891209
FT                   GB|NM_021474, evidence: BLASTN, 99%, match=1469)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542X5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR026824"
FT                   /db_xref="MGI:MGI:1891209"
FT                   /db_xref="UniProtKB/TrEMBL:Q542X5"
FT                   /protein_id="BAC35838.1"
FT                   /translation="MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEW
FT                   DADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQ
FT                   QPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECV
FT                   DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYG
FT                   TFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLC
FT                   QDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQP
FT                   SSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAML
FT                   VLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF"
FT   regulatory      1525..1530
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1543
FT                   /note="putative"
XX
SQ   Sequence 1543 BP; 313 A; 457 C; 431 G; 342 T; 0 other;
     ggggccgcgc gtccagtgag ctgcgcggtc cgtccgtccg tccgcccgcc cgcaggcact        60
     gctggagtcg acgccctcag gatgctccct tttgcctcct gcctccccgg gtctttgctg       120
     ctctgggcgt ttctgctgtt gctcttggga gcagcgtccc cacaggatcc cgaggagccg       180
     gacagctaca cggaatgcac agatggctat gagtgggatg cagacagcca gcactgccgg       240
     gatgtcaacg agtgcctgac catcccggag gcttgcaagg gtgagatgaa atgcatcaac       300
     cactacgggg gttatttgtg tctgcctcgc tctgctgccg tcatcagtga tctccatggt       360
     gaaggacctc caccgccagc ggcccatgct caacaaccaa acccttgccc gcagggctac       420
     gagcctgatg aacaggagag ctgtgtggat gtggacgagt gtacccaggc tttgcatgac       480
     tgtcgcccta gtcaggactg ccataacctt cctggctcct accagtgcac ctgccctgat       540
     ggttaccgaa aaattggacc cgaatgtgtg gacatagatg agtgtcgtta ccgctattgc       600
     cagcatcgat gtgtgaacct gccgggctct tttcgatgcc agtgtgagcc aggcttccag       660
     ttgggaccta acaaccgctc ttgtgtggat gtgaatgagt gtgacatggg agccccatgt       720
     gagcagcgct gcttcaactc ctatgggacc ttcctgtgtc gctgtaacca gggctatgag       780
     ctgcaccggg atggcttctc ctgcagcgat atcgatgagt gcggctactc cagttacctc       840
     tgccagtacc gctgtgtcaa cgagccaggc cgattctcct gtcactgccc acaaggctac       900
     cagctgctgg ctacaaggct ctgccaagat attgacgagt gtgaaacagg tgcacaccaa       960
     tgttctgagg cccaaacctg tgtcaacttc catgggggtt accgctgtgt ggacaccaac      1020
     cgttgtgtgg agccctatgt ccaagtgtca gacaaccgct gcctctgccc tgcctccaat      1080
     cccctttgtc gagagcagcc ttcatccatt gtgcaccgct acatgagcat cacctcagag      1140
     cgaagtgtgc ctgctgacgt gtttcagatc caggcaacct ctgtctaccc tggtgcctac      1200
     aatgcctttc agatccgttc tggaaacaca cagggggact tctacattag gcaaatcaac      1260
     aatgtcagcg ccatgctggt cctcgccagg ccagtgacgg gaccccggga gtacgtgctg      1320
     gacctggaga tggtcaccat gaattccctt atgagctacc gggccagctc tgtactgaga      1380
     ctcacggtct ttgtgggagc ctataccttc tgaagaccct cagggaaggg ccatgtgggg      1440
     gcccccttcc ccctcccata gcttaagcag ccccgggggc ctagggatga ccgttctgct      1500
     taaaggaact atgatgtgaa ggacaataaa gggagaaaga agg                        1543
//