Dbfetch

ID   AK054579; SV 1; linear; mRNA; STD; HUM; 1558 BP.
XX
AC   AK054579;
XX
DT   31-OCT-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens cDNA FLJ30017 fis, clone 3NB692000484, highly similar to
DE   Ubiquitin carboxyl-terminal hydrolase isozymeL1 (EC 3.4.19.12).
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1558
RA   Isogai T., Otsuki T., Sugiyama T.;
RT   ;
RL   Submitted (24-OCT-2001) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Nishi T., Nakagawa S., Senoh A., Mizuguchi H., Inagaki H., Sugiyama T.,
RA   Irie R., Otsuki T., Sato H., Wakamatsu A., Ishii S., Yamamoto J., Isono Y.,
RA   Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K.,
RA   Nakamura Y., Sekine M., Kikuchi H., Kanda K., Wagatsuma M., Murakawa K.,
RA   Kanehori K., Takahashi-Fujii A., Oshima A., Sugiyama A., Kawakami B.,
RA   Suzuki Y., Sugano S., Nagahari K., Masuho Y., Nagai K., Isogai T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 420a47bf5b56e04354293bcf906bddd5.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   Economy, Trade and Industry of Japan; cDNA full insert sequencing:
CC   Research Association for Biotechnology (RAB); cDNA library
CC   construction: Helix Research Institute (HRI) (supported by Japan
CC   Key Technology Center etc.); 5'- & 3'-end one pass sequencing:
CC   RAB, HRI, and Biotechnology Center, National Institute of
CC   Technology and Evaluation; clone selection for full insert
CC   sequencing: RAB and HRI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1558
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="3NB692"
FT                   /clone="3NB692000484"
FT                   /cell_line="NB69"
FT                   /cell_type="neuroblastoma"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             775..1203
FT                   /codon_start=1
FT                   /note="highly similar to Ubiquitin carboxyl-terminal
FT                   hydrolase isozymeL1 (EC 3.4.19.12)"
FT                   /db_xref="GOA:A6NLJ7"
FT                   /db_xref="H-InvDB:HIT000011193.17"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="UniProtKB/TrEMBL:A6NLJ7"
FT                   /protein_id="BAG51393.1"
FT                   /translation="MKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSP
FT                   EDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNH
FT                   GASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA"
XX
SQ   Sequence 1558 BP; 307 A; 437 C; 476 G; 338 T; 0 other;
     agctgttttt cgtcttccct aggctatttc tgccgggcgc tccgcgaaga tgcagctcaa        60
     gccgatggag atcaaccccg agatgctgaa caaagtgagt ggcgtctcgc gccgtctctg       120
     gccccctccc ccgcgagcgc cgaggcgggg gcgcccaccg gttccggctg ctggcaggga       180
     ccaagccgcc cgctgcgagc accggagacg gccgggctgg ggcgtgggct gggcgccttt       240
     cctgggcccc tgcatttagc gggtgactct acgaaaccgg tcacggggag acggaggggg       300
     ctgcgccccg tggcgagcga gcgccaggcg gagctcccga gggcgtggcg cgggcagcac       360
     agactcggct gcacgggctt cgcgggcgcc acgtgtgggc cgcgctttgt gctgtgtcat       420
     tgcgccggcc cgggtggggg tggcagggcg ggactggggc tcctcccagg ctcgggtgcg       480
     ggcgcggagg gcgcgcgcct cctggccccg ccccctggca ggtgcccgcg acccgcgtgt       540
     ccccgtgcgc ctggccgcct tgtctcctct ccgcaggtgc tgtcccggct gggggtcgcc       600
     ggccagtggc gcttcgtgga cgtgctgggg ctggaagagg agtctctggg ctcggtgcca       660
     gcgcctgcct gcgcgctgct gctgctgttt cccctcacgg cccagcatga gaacttcagg       720
     aaaaagcaga ttgaagagct gaagggacaa gaagttagtc ctaaagtgta cttcatgaag       780
     cagaccattg ggaattcctg tggcacaatc ggacttattc acgcagtggc caataatcaa       840
     gacaaactgg gatttgagga tggatcagtt ctgaaacagt ttctttctga aacagagaaa       900
     atgtcccctg aagacagagc aaaatgcttt gaaaagaatg aggccataca ggcagcccat       960
     gatgccgtgg cacaggaagg ccaatgtcgg gtagatgaca aggtgaattt ccattttatt      1020
     ctgtttaaca acgtggatgg ccacctctat gaacttgatg gacgaatgcc ttttccggtg      1080
     aaccatggcg ccagttcaga ggacaccctg ctgaaggacg ctgccaaggt ctgcagagaa      1140
     ttcaccgagc gtgagcaagg agaagtccgc ttctctgccg tggctctctg caaggcagcc      1200
     taatgctctg tgggagggac tttgctgatt tcccctcttc ccttcaacat gaaaatatat      1260
     acccccccat gcagtctaaa atgcttcagt acttgtgaaa cacagctgtt cttctgttct      1320
     gcagacacgc cttcccctca gccacaccca ggcacttaag cacaagcaga gtgcacagct      1380
     gtccactggg ccattgtggt gtgagcttca gatggtgaag cattctcccc agtgtatgtc      1440
     ttgtatccga tatctaacgc tttaaatggc tactttggtt tctgtctgta aattaagacc      1500
     ttggatgtgg tttaattgtt tgtcctcaaa aggaataaaa cttttctgct gataagat        1558
//