spacer

EBI Dbfetch

ID   AK054098; SV 1; linear; mRNA; HTC; MUS; 1810 BP.
XX
AC   AK054098;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days pregnant adult female oviduct cDNA, RIKEN full-length
DE   enriched library, clone:E230017N19 product:regulator of G-protein signaling
DE   5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1810
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d6327a43d729a99c2152ebf37d90011d.
DR   Ensembl-Gn; ENSMUSG00000026678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027997; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E230017N19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1810
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="2 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E230017N19"
FT                   /tissue_type="oviduct"
FT                   /db_xref="taxon:10090"
FT   CDS             79..624
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signaling 5 (MGD|MGI:1098434
FT                   GB|NM_009063, evidence: BLASTN, 99%, match=793)"
FT                   /db_xref="GOA:O08850"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1098434"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08850"
FT                   /protein_id="BAC35655.1"
FT                   /translation="MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPE
FT                   KPAKAHKPSLEEVLQWRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIK
FT                   SPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALME
FT                   KDSLPRFVRSEFYKELIK"
FT   polyA_signal    1784..1789
FT                   /note="putative"
FT   polyA_site      1810
FT                   /note="putative"
XX
SQ   Sequence 1810 BP; 526 A; 378 C; 377 G; 529 T; 0 other;
     gagattattg aagtttccac agacggtcag ctgttgagag gttcgtgctc aagttgagga        60
     tctaagccgc cagccaaaat gtgtaaggga ctggcagctc tgccgcactc atgcctggaa       120
     agggccaagg agatcaagat caagttggga attctcctcc agaagccaga ctctgctgtt       180
     gaccttgtca ttccatacaa tgagaagcca gagaagcctg ccaaggcaca caagccctca       240
     ctggaggagg tcctgcagtg gcgccagtcc ctggacaagc ttctccagaa cagctatgga       300
     tttgccagct tcaaaagttt cctgaagtct gaattcagtg aggaaaacct tgagttctgg       360
     gttgcctgtg agaattacaa gaagatcaag tcccccatca aaatggcgga gaaggcaaag       420
     caaatttatg aagaattcat ccagacagag gcccctaaag aggtgaacat tgaccacttc       480
     actaaagaca tcaccatgaa gaacctggtg gaaccgtctc ctcgcagctt tgacttggcc       540
     cagaaaagga tctatgccct gatggagaag gattctctgc cccgctttgt gcgctctgaa       600
     ttttataagg agctaatcaa gtagtcatct ggtcaggctt ccaaaagttg ccctgtgagt       660
     tgagttacat cctttgtagc aacacagcat cctcccaggc acctgcacag ttctccatag       720
     cagctttgct ccaagataca caaacatagg caaaccacag gctgtgttgc taactctttc       780
     gctcatgtta gtttggttat gtggatctgt tgtctaagag ccctcacttt tttctttttc       840
     tttttttttt cttttttttg gttctttctg actgctttgt aataaagatt taccaagtca       900
     ttgtcagtct aagtcacaaa aatatccagt ttaacataaa gctgtctgtg caaagaatag       960
     gtgatagact gctattttaa ccaggctgaa aagaaaaaca gatgcaagtg tcccctttca      1020
     tggggatttg actggtcttg tttattgttt taattcttat tctctaatgg cttcagaatt      1080
     tggttagtaa aatagcagca agctggtcat aaggcagcca ccgttgggtt tttcagcaaa      1140
     tgcattattt aacactactg atctctcctt tctagagtac cgctgtgtta tctggacatt      1200
     ctcaataaga gatacaatga atacattgtg cttctaaaca ggattcattt caatcctgcc      1260
     cttcatgttt ccaaatctcg aggggaaaat ggcagccttt gactttctcg aacaattaga      1320
     aatgctaatg cccagacatt ttttgagctg tttcttaaac aatggaaaca ataatttaaa      1380
     attaatattt tcttcacatt agttggaata gccgaatgtc tgaaaatacc caaggagtga      1440
     accggctgtt acacactcac tcagatgcct cctgtcattg taacctcaat tgactctgct      1500
     cacaaattgt gtgattggtt agtcttgtca gtgcagggtg agaagggtag gaagggtgcc      1560
     tcaagggcag tgctgtgagg ccacaaaagg atgcaggcag gcatgcttct gcagtctaag      1620
     ggctgcatta tatatccaga tatttactgt atcactatat aattttaaat ttagagcaat      1680
     atatatacat acacacacac atatatatac atatatattt ttctaatata taaaatactc      1740
     aatgggcgat aagtagtcta gttccaaagg aaaagccaaa tgtattaaaa ttggactaga      1800
     aactatttgt                                                             1810
//


spacer
spacer