spacer

EBI Dbfetch

ID   AK053889; SV 1; linear; mRNA; HTC; MUS; 3343 BP.
XX
AC   AK053889;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130318H09 product:inferred: protein O-mannosyltransferase 1
DE   {Rattus norvegicus}, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3343
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f11330cd3938fb1161a8124e6f1c4c86.
DR   Ensembl-Gn; ENSMUSG00000039254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036473; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130318H09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3343
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130318H09"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             1762..2784
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="inferred: protein O-mannosyltransferase 1 {Rattus
FT                   norvegicus} (TIGR-MGI1|TC9582, evidence: TGI)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8R2R1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="MGI:MGI:2138994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R2R1"
FT                   /protein_id="BAC35577.1"
FT                   /translation="MTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWKLDIVNR
FT                   ESNRDTWKTILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKLSPGYHESMVWNV
FT                   EEHRYGKSHEQKERELELHSPTQLDISRNLSFMARFSELQWKMLTLKNEDLEHQYSSTP
FT                   LEWLTLDTNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRRRSICDL
FT                   PEDAWSRWVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDH
FT                   LCRSQLQRNVFSALVVAWYSSACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDILIRK
FT                   "
FT   polyA_signal    3323..3328
FT                   /note="putative"
FT   polyA_site      3343
FT                   /note="putative"
XX
SQ   Sequence 3343 BP; 771 A; 931 C; 870 G; 771 T; 0 other;
     gggttcgcag gcctggctcc acatgaggag ccactctacg ggactcgaag aaacgctcgg        60
     agtcctcccg agctggcttt tctgcaaaat gttaagattt ttgaaacggc ctctagtggt       120
     gactgttgac atcaatttga acttggtagc tctgactggc ctgggactac ttacccgact       180
     atggcaactc tcctaccctc gggctgtggt tttcgatgaa gtatattatg ggcagtacat       240
     ttccttctac atgaagcgca tcttctttct ggatgacagt gggccaccat ttggccacat       300
     gctactggcc ttaggaggtt ggttaggggg attcgatggt aactttctgt ggaaccgaat       360
     tggagcagag tacagtagca atgtgcctat atggtcctta cgcctgctgc cagcgcttgc       420
     cggggccctg tcagtgccca tggcctacca gatagtgcta gagctccact tttcccacgg       480
     tgctgccatt ggagccgccc tgctgatgct cattgagaac gccctgatca ctcagtccag       540
     gctcatgctg ttggagtcca tactgatatt ttttaacctg ttggctgtgt tgtcctatct       600
     gaagttcttc aactcccaga cacacagccc tttctcagtg cactggtggc tgtggctact       660
     gctgaccggg gtctcttgtt cctgtgcagt tgggatcaaa tacatgggga ttttcaccta       720
     cctgcttgtg ctcggcattg cagctgtcca cgcgtggaat ctgatcggag accagacctt       780
     gtcaaatgta ggtggtcaca ccagggcctc gtgaatctgc tgtatgtggg gattagggtg       840
     tcaagctgtc ctagggagta gttggcttaa agaagtggag cctctggatc ctcagggctg       900
     gagagatggc acagtggtta cgagcactga ctgctcttct gaaggtcctg agttcaattc       960
     ccagcaacta catggtggct cacaaccatc tgtaatgaga tctgatgccc ttttctggtg      1020
     tgtctgaaga ggctgacaat gaactcacat acataagata aataataaaa ttaaaaagta      1080
     aaaaagaaga agaagaagga ggaggagaag gagaaggaga agaagaggat cttcaaggct      1140
     tcaggagcag ggagtaggga agctggcgcc cctgtgagct tctagcagca tctacctggg      1200
     acaaagggct tcagggtttc tcaggaactt ccctgagcct ccatgcaggt tctggaaatg      1260
     gctaccgcac tctgcagatc gaaagaccta tcctctcacc cctggcagat gcgcgtgctc      1320
     agtcacttgc tcgccagaat cgtggctctg ctggtcgtcc cagtcttcct gtacttactc      1380
     ttcttctatg tccacctgat gctgctctac cgctctgggc cccatgacca aatcatgtcc      1440
     agtgccttcc aggccagctt ggagggaggg cttgcccgca tcacccaagg ccagcccctg      1500
     gaggtggcct ttggttccca ggtcactctg aagagcgtct ctggcaaacc cttgccctgc      1560
     tggcttcatt cgcacaagaa cacctatccc atgatatatg agaatggccg tggcagctcc      1620
     caccagcaac aggtgacctg ttatcccttc aaagacatca ataactggtg gatcgtcaag      1680
     gatcctgggc gacaccagct ggtggtaaac aaccctcccc ggcctgtaag acatggagac      1740
     attgtacagc tcgttcacgg catgaccacc cgcctcctta acacgcacga tgtcgcagcc      1800
     ccactgagcc cccattctca agaagtctcc tgctacattg actataacat ctccatgcct      1860
     gcccagaacc tctggaaact ggacattgtg aacagagagt ccaaccggga tacctggaag      1920
     actatcttgt cggaagtgcg ctttgtacat gtgaacacat ccgccatctt gaagctgagc      1980
     ggggctcacc tccctgactg ggggttccgg cagttggagg tagttgggga gaagttgtca      2040
     ccgggctacc acgagagcat ggtgtggaat gtggaagaac accggtatgg caaaagccat      2100
     gagcagaagg agagggagct ggagctccac tcgcccactc agctcgatat cagcaggaac      2160
     ctcagcttca tggccagatt ctcagagtta cagtggaaga tgctgacgct gaagaatgag      2220
     gacttggaac accagtacag ctccaccccg ctggagtggc tcacgctgga caccaacatc      2280
     gcctattggc tacatcccag gaccagtgct cagatccact tgcttgggaa cattgtgatc      2340
     tggacttcag ccagccttgc cacagtggtc tacactctac tcttcttctg gtacctgctc      2400
     cgccggcgaa ggagcatctg tgacctccct gaggatgcct ggtcccgctg ggtgctggct      2460
     ggagccctgt gtactggcgg ctgggcactc aactacctgc ccttcttcct gatggagagg      2520
     gtgctcttcc tctaccacta cttgccggca ctcaccttcc agatcctgct gctcccgatt      2580
     gtcctgcagc acgccagcga ccatctgtgc aggtcccagc tgcagaggaa tgtcttcagt      2640
     gccctggttg tagcatggta ttcctccgca tgccatgtgt ccaacatgct acgcccacta      2700
     acctatgggg acacgtcact ctcaccaggc gagctccggg cccttcgctg gaaagacagc      2760
     tgggatattc tgatccgaaa gtaatagaga acaagaacac agaagacaag cacacaggac      2820
     aaagcctcaa agatgtgttt gtctcccacc aacaggagcc tcagcaggca ggactgccag      2880
     ggtccaggag gaactccagg gactaattcc aatttcacct caagagccct gtccactggt      2940
     tccttgtttg aagcaattga tttctcttca cacagtgaag aatgtgccca gccacagcgt      3000
     tacccatgag gcccaactct gacccagcca gagtttgagc tgccagtgta ggaaccacca      3060
     aggcaggagg ggcacccagc cagggaagga gtggggggga ctcaggacga gctgcgggcc      3120
     tactataggg ccttagccct gtcatttatg gggcccacag tgccacacct cattgggcac      3180
     aggcacagcc accctctgta aaccctgaaa gctgccagcc atccacagac tcctgagcca      3240
     actctaaaga gtcctgggag actgcagcca cctaactgcc acggccaagg tgtcgtccat      3300
     tcacttcctt acctttaatg taaataaaac aggacaaatt gct                        3343
//


spacer
spacer