spacer

EBI Dbfetch

ID   AK053538; SV 1; linear; mRNA; HTC; MUS; 2620 BP.
XX
AC   AK053538;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130106K16 product:glycoprotein m6a, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2620
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 53a5939913c4e1603e0ed9ba8cb28c1a.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130106K16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2620
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130106K16"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             106..942
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glycoprotein m6a (MGD|MGI:107671 GB|S65735,
FT                   evidence: BLASTN, 99%, match=1195)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542P2"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/TrEMBL:Q542P2"
FT                   /protein_id="BAC35419.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
XX
SQ   Sequence 2620 BP; 722 A; 483 C; 537 G; 878 T; 0 other;
     gactgctgct ggagctgccc agggaaaaaa ggcacacgct tttttgacat ctaattgagc        60
     ttttgactaa taccgtgcgc cagattctcc tgaagaaagg tagccatgga agagaatatg       120
     gaagaaggac agacacagaa agggtgcttc gagtgctgca ttaaatgcct gggaggtatt       180
     ccctatgctt ctctgattgc aaccatcctg ctgtatgcag gcgttgccct gttctgtggc       240
     tgtggccatg aagccctttc tggaacagtc aacattctgc agacctactt tgagttggca       300
     aggactgctg gagacacact ggatgttttc actatgattg acatctttaa gtatgtgatc       360
     tatggcattg cggctgcttt ctttgtctat ggcattttac tgatggtaga aggtttcttc       420
     acaactgggg ctatcaaaga tctctatgga gacttcaaaa tcaccacctg tggcagatgt       480
     gtgagcgctt ggtttatcat gctgacatac ctcttcatgt tggcctggct gggagtcaca       540
     gctttcacct cactgcccgt gtacatgtat ttcaatgtgt ggaccatctg ccggaacacc       600
     actctagtgg agggagcaaa tctctgcttg gatctgcgtc agtttgggat tgtgacaatt       660
     ggagaggaaa agaaaatttg tactgcctct gagaacttcc tgaggatgtg tgaatctact       720
     gagctgaata tgaccttcca cttgttcatt gtggcacttg ctggagctgg agcagcagtt       780
     attgctatgg tccactacct gatggttctg tctgccaact gggcctatgt gaaagatgcc       840
     tgccgcatgc agaagtacga agacatcaag tcaaaggaag agcaggagct gcacgacatc       900
     cattctactc gctccaaaga gcggctcaat gcgtacacat aaatacgctt ctctgttcct       960
     taccactcga aggcattggt gtttcattaa gggccatcca accatccaac ctgtgaagag      1020
     caaaacgaga atgctactca tcaaagatgc gcagggtgac taatgaatca cctgagtata      1080
     actctttgct gttgagcatt ccatcttcta atttgttaaa ttggaatgac caaatctcct      1140
     ctacaagctc ctattcagtc ttttttttta acctctcaaa ttgatttagt tcttctgtat      1200
     gatcaaagat attaacattg tccaacgcaa atctttgttt gatttttaat cacctcccac      1260
     atatcacaca taacactttt tgcattgttt cttatgtttt ggaagagaaa atagcttttt      1320
     ttatactttt tagttttgat ttcagtaact agtttaacta caggtaacct tcaaagggac      1380
     cgttgtacat tatgaaagag agacagagat ggtatcatga tgactccgct tgatatggga      1440
     atcagtctgg agagatcagt ggccacacgg ctatcggcca tggttaatgt tttcatccat      1500
     ctaaggtgca atttcaaaat ttctaagggt aggttaaaaa aaagtgcttc ttatctttgt      1560
     taacattgta ttcttttttc ttgatgttcg taaaaggtat ttctctgatt actcatgttt      1620
     atgttgtgag catgtagaaa cagtaatgct aatgcatggc cagttgcctt cctaagattg      1680
     tgacaccagg cttacctttt caagtttagt atagaaacaa ttatcatgga aataactact      1740
     gtggactgtt ggagagtgat ctttttttgt gatttatgca gtggctggat tggatctttt      1800
     aatatgctaa tgtggaaaat taattacctt tatgaaggtg gtatcttaaa cataagcaca      1860
     ctaaaccctc aagacttgtt ttacccactt aaaactttta acggattgca cctctgtaag      1920
     ctatttctta aaatgtgtat gatatatttg aaaagacttc cattaatata ataggctttg      1980
     cttgcagcct tccaatctat gttggtttac ctgtagtgtt tctaaagggt ggtcagaggc      2040
     cactagagaa tgtattgttt gggagtgtag tgatatatat tttgtgtttt tatttcaagt      2100
     aagtcatttt aaccaaatgt tcattcacat tcatttataa gaagtaccta tatcagacaa      2160
     attttaaaag aaaaacaatc agtattaatg gaccaaattt cgtgtttgtt ttaaccttga      2220
     ctctcttttg attctttcta atgctacaag aatgctgtga aatgtcattt aaaataatga      2280
     tgtagcctga caagaaattt tgtcagtgta taaacctagg tagtattgtg cactgatttg      2340
     accattgtga attcctcctt cagtgtaagt gcattcccaa taaaatttat tgagtgaaac      2400
     aatctttgta caactactag tcatgcatca tcagtaattt tacaagttct tgtagtaggt      2460
     agggggtatt actagcgttt ctgtggcatg attatgcatt ctgtaatatt aatttggggg      2520
     tccttttgct ttttaacact tagattatct taatggttca acatttttct gatatatgca      2580
     gtattaaaga tattgagcaa aagtattaat gggcttcttt                            2620
//


spacer
spacer