spacer

EBI Dbfetch

ID   AK053287; SV 1; linear; mRNA; HTC; MUS; 2777 BP.
XX
AC   AK053287;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130007J18 product:G PROTEIN-COUPLED RECEPTOR 37, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2777
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b6141c359aa159e6adef2b5b47997f25.
DR   Ensembl-Gn; ENSMUSG00000039904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054867; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130007J18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2777
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130007J18"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             190..1239
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G PROTEIN-COUPLED RECEPTOR 37 (MGD|MGI:1313297
FT                   GB|NM_010338, evidence: BLASTN, 99%, match=2171)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9QY42"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1313297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY42"
FT                   /protein_id="BAC35333.1"
FT                   /translation="MCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLLANLAFWDFL
FT                   IIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRFRAATNVQM
FT                   YYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGQAPAERCVIKISPDL
FT                   PDTIYVLALTYDGARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKASTRGNKRQIHL
FT                   ESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFFKSCVT
FT                   PVLLFCLCRPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIRREMS
FT                   TFASVGTHC"
XX
SQ   Sequence 2777 BP; 730 A; 611 C; 564 G; 872 T; 0 other;
     gacaggcctt cagcagtaca cgaaggaagg acccttgctc ctccaggcag ggcactaccg        60
     caaaacgggt ctgcagatga ctgggttcct gaccaagggg gtccacgccg tggaaacacc       120
     acgcggcgcg tgagattgaa gaaccccttc tacccattga cccaagaatc ctacggagcc       180
     tatgcggtca tgtgcttatc tgtggtgatc tttgggaccg gcattattgg caacttggca       240
     gtgatgtgca tcgtgtgtca caattactac atgaggagca tctccaattc tctcttagcc       300
     aacctggctt tctgggactt tctcatcatc ttcttctgcc tccccctggt catcttccat       360
     gagttgacta agaagtggct tttggaagat ttctcctgca agatcgtgcc ctatatcgag       420
     gtggcttctc tgggtgtcac taccttcacc ttatgtgcac tgtgcataga tcgcttccgg       480
     gctgccacca acgtccagat gtactatgaa atgattgaaa attgctcttc caccactgcc       540
     aaacttgccg ttatctgggt tggagctctg cttttggccc ttccggaagt tgtcctccgc       600
     cagctgagca aggaagattt gggctttagt ggccaggctc ctgcagaacg gtgtgtcata       660
     aagatctctc ctgatttacc ggacacaatc tatgttttgg ctctcaccta tgatggtgca       720
     aggctttggt ggtattttgg ctgctacttt tgtctgccca cacttttcac catcacctgc       780
     tctctagtga ctgctcggaa gatccgcaaa gcggagaagg ccagtacccg tggaaacaag       840
     cggcagatcc atctagagag ccagatgaac tgcacagtgg tggctctgac cattttatat       900
     gggttttgca tcatccctga gaatatctgc aacattgtca ctgcctacat ggccacgggc       960
     gtctctcagc agaccatgga cctgctcaac atcatcagcc agttcctttt gtttttcaag      1020
     tcctgtgtca cccccgtgct cctcttctgc ctctgcagac ccttcagcag ggccttcatg      1080
     gagtgctgct gctgctgctg tgaggagtgt atccagaagt cttccactgt gaccagtgac      1140
     gacaacgaca acgagtacac cacagagctg gagctgtcgc ccttcagtac tatccgcagg      1200
     gagatgtcca cttttgcttc tgtggggact cattgctgaa ggaacggctt ggttagctct      1260
     gatttcttcg attttcatat tctgtgaaaa tttttactcc atatttttcc ttacagggga      1320
     acaatgcaca cattttgaaa agcaagtaga ggaagacata ttaactactc tagaactgat      1380
     tttgcaaatt aatatttgtg ctctgggaaa aaatgtttct atttagttat gtaagaagaa      1440
     ggaggccaac agtctcagat catttttttc tgctatggtg ctaatatttt attcaaaagt      1500
     tattgcacct taacaatatt aattgtttga tttctttctt tcttttaaaa acataatcgt      1560
     tgtatattga aggcaggccc gggattttgc tagttatttt gtgtttgagt tgtgattgga      1620
     agtacattgt atttgaaatg gtttgttttt tccagccatg caacttagca ccaaataaac      1680
     ttctcatcct tctttaatat gactgtcaat ctacttttaa ccaagactca ataaattttt      1740
     taattgcctt aaataacaca attgctggtc ctatgcacag tttaaaactg gccttactgt      1800
     tttataatta catcttactt taaaggagtg aatcgctgtg ttataaggaa atattttaaa      1860
     aagaatactc tttaactgca taactcataa aactatattg tacattaaaa tgaggtattt      1920
     ttagcattca cacatagctg taaaatcact actgcgtatt tgtaaaatat gaatagacag      1980
     aagaataggt ggagagttct ctttctttgt attttacagg tacctttgat ctggcacatg      2040
     gaggcacagg tgttcccagg aggaactata ggctgactga aagccgagaa acagtgtact      2100
     tggcatctga ttctgtccac agaacagtag cctctgaagt tgtatggctc atatgtgcag      2160
     tgctctgaat tctagtagtc cttcttgatt atttttattt aatttttttt ctgagaattt      2220
     cttagaagta ctccattcaa atgatttcca gcactccttt cgccttccaa ctccctcaaa      2280
     ttcatacttt aaaaaatgaa cctaattaaa tctctagagt gaggttttta tatggaacag      2340
     aagtatagct atataataat aagatacata tgtatcttga ttagagtaca tgagtattca      2400
     aatactacat ttaaatggat atttaataaa attcccccac ccccaaatct aaccctgccc      2460
     attcagttga gcacatggag cttggcatgt gtgttacatg tctagatgag atggcagaat      2520
     ctggcctgga gacaaagcaa tttcttttaa gtttcaagaa aatgtgggtg gttgaatgcc      2580
     tgtgccttca gcaaaacaag cccaattatg tttgcacagt gtttcctacc tgttggcttc      2640
     tgtgttcttt aacatctctg agtcagtgcc atcttcaaaa tgctagcttg atgttattta      2700
     cgccactcaa atgcagtgat tgaaaactta agagagtcaa ctcaactaat ttacatccct      2760
     gaaaaaccca gatcagc                                                     2777
//


spacer
spacer