spacer

EBI Dbfetch

ID   AK053281; SV 1; linear; mRNA; HTC; MUS; 3671 BP.
XX
AC   AK053281;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130006J24 product:K+ voltage-gated channel, subfamily S, 2,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3671
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000050963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072868; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130006J24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3671
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130006J24"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..380
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="K+ voltage-gated channel, subfamily S, 2
FT                   (MGD|MGI:1197011 GB|NM_008436, evidence: BLASTN, 98%,
FT                   match=950)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BPU9"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197011"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BPU9"
FT                   /protein_id="BAC35332.1"
FT                   /translation="EENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILA
FT                   GILVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLM
FT                   ASLTNMSRSSPSELSLDDSLH"
XX
SQ   Sequence 3671 BP; 975 A; 727 C; 859 G; 1110 T; 0 other;
     aggaggagaa cgaaggcctg gccaccatcc ctgcctgctg gtggtgggcc actgtcagta        60
     tgaccacagt tgggtacgga gatgtggtcc cagggacaac agctgggaag ttgactgcct       120
     ctgcctgcat cttggcaggc atcctggtgg tggtcttgcc catcactttg atcttcaata       180
     agttctccca tttctatcgg cgccaaaagc aacttgagag tgctatgcgc agctgtgact       240
     ttggagatgg aatgaaagag gtcccttcgg tcaatttaag ggactactat gctcataaag       300
     ttaagtccct catggcaagt ctgacaaaca tgagtaggag ttcacctagt gaactgagtt       360
     tagatgattc tctacattag ctggaccccg acttacattg ctgatctgct gcttgtggtt       420
     ctagcacaat cagggcaatt ttagggctgt ggcataagaa atcatccctg ccctagaggg       480
     agagctgcat gggacataag ccctagattg cttttgcaat gtttagagag gtttcttttt       540
     tcttttgagg atggtgtgtc taataacatg cctttgcacc tctcagtgaa gtgacactca       600
     ctggtgtttg catcatggca aaaaaaaaaa tgttcacctt tctgccagat gagtatctag       660
     aatgccaatt tctctgtcca ctgtgtacag tattctaatg ctcatatccc agcattacct       720
     gtgagtggaa ttgtctgtgc tcctatttcc gaggctgctg tatgggttcc agtgacaaca       780
     catctgtcta tgaggtcagc aaggatatcg tgagatttgg atcacaacca tgtgaaaata       840
     atctcaatta tgtatccctt gctttcattt acctttaata ccaaaacaga gagatcgcaa       900
     agctaagcac acttgaccaa tgcaaatctt cgagttgtct ttctacttgg tcctgtcctt       960
     gtgatgtgca tgaatgcacc agtcatttta aagaaagata tgtattgatg tatatctcct      1020
     aagtgtcagt gtaaagagaa tgttacttag tcgatatgta gtaaagactg aatgtttttc      1080
     ctccaaacag ttaaatttag ggacagcgac tttagctaaa catggaccaa accccaggag      1140
     ttcatgtagg ctaagccctt ttactgatgg tcaggcctct tttcatttat ttctggctga      1200
     gatgctcaat ccaggccatt ttgaccaaag tttgctgtgt cttggtatta gcatgttttt      1260
     caagcatctc ttttttaaga tgtttaggaa taaggccgtg ctgtctttct cctccactgg      1320
     aagaagtttg tgttttgttg tctttgtgag gtaagcactg tcaggttgct ggcaagggca      1380
     atagcttaaa tattttcttg cctgctctaa aagcccataa aatgaatgtt cttttgtttc      1440
     tgagcagagt ttcctttagg tagttttgct tctaggacac aggatagtgt atgtatagtg      1500
     tttgattgcc ttgagttcct gccttggcat ggaaacctgg tagtgcagag catattcaag      1560
     atgcagacat gcatgaaggc aggtagctta cccagggtgg aaacactgta gcttttattt      1620
     ccattgcaat tgcaatgggg tttgggggac aggggtagaa gtcaaaagaa aagagttata      1680
     aagccaaaaa ctactttata agatataaat aactgtgagc ttctttaaaa gcttaaaact      1740
     agtaaaatag aaaacaaaaa caacaaacaa ccctttcaac cattaagctg tgttgaaggg      1800
     ttacctctat ttccttttcc aacacactgt tcagttaaca caaaacatta tgaaggggca      1860
     cctgggcccc ctttaagaaa attctttccc atcattgtct aagtaatctg atggttttcc      1920
     agtggctttc attattgttg agtctttggc aaggctatag aatccaggga tccaaatacg      1980
     gagataaaca ggcttttaat ccaaagtttg ggcctactct taattggtcc attttgtgtt      2040
     ttagtcagtt aaggacaatc cacacttcac aggggtgtgg aatggatctt ctcagagggc      2100
     tctgtgtact agtggttgcc atggtgacta cagtgtgggc gatttgttgg atgaatgcac      2160
     tgaccattta atgcccttga gcctccagtt cagatctttc atcagactgg agactgatga      2220
     ggggcagaag gtggcaacct cctagtgcct acgtgcagac acatctatgt ctattattcc      2280
     aaagcagcag gaatgtgagg ttgacttcaa ggaaccccgc ctgtgaatca gaagacagga      2340
     gttggttttg ggagtttgca tatggaactc ttgttgttgg ctggtatctt cagcactaga      2400
     agaccaagga tgtataaaac tgttcccagt tgcactgaag gcaggggaca gcctaacctg      2460
     tgaggactgt ttggtttgct gaggctgatg gtataccata actgggcatg aattgcatgg      2520
     tcactgacca tgaagctgat ggaaagaaga aaagaggaga tgcagagtaa cttagccact      2580
     ctcctaagga tttttctaaa tgaacatgtt taacaccaaa aaggagatac ctgcaaggat      2640
     atgaaagctg gaaaacttga cttttctttt ttggtgatga cttgttttat ctggtgcctt      2700
     tcattggggg aatcccaaag tgctttagag actgtctttt taacatttct tgtagatata      2760
     tgtataattg taaaagaata ttcctttgcc caccaagact tttagtcgct tctgagcatg      2820
     aaaaggtccc aggagcatta agttccccca agcagtagtt tcatagacct tgagggaggg      2880
     ccatccagat ggctgggctc tgcagtgatc tccatagacc ataaagaatg gtgtaaaggc      2940
     cctgggaacc tttcccttat cactgaacta cacggaggta tgaagttcac aagtcctgga      3000
     tcagacacaa agcctctgac tagtcaagtc agataatgtc tcccatggta gtttctcctc      3060
     caggagagag cagattcatt ttctgccgtg ttcttgggag taaaggctac caagatgaag      3120
     tggactcata gatgatcaag gtagcctgta caatcctttc ttggggaaca cagtagatgc      3180
     aggctcattc atacccagct ggtagctaaa gagcaactcc actcttggca tttgacctgt      3240
     tcagtattac tgggtcaaat acatgggcca agctttgtca tagcatgcag ggtgggcatt      3300
     tggaactgac acacgtttat ggcacagata cattagtctg gggctgtgtt tcccatccaa      3360
     gttctgcatt tcccaggttg gctgctgagg aggggcgtgt agaatgctga gcctatgcct      3420
     agctcatcag gtagtaattg atgtttaata tttgggtttg ttattgctac ttactgtagc      3480
     tctcaaagca ctgagcgacc tgttaattcc tgctttgttt caatggaaat gatttgttct      3540
     gcactttggg atatcggcgg tagagaccac aggcagtgtg gtctctactt gaaagcttaa      3600
     ctggtatttc ttgtatgttt taacagcatg acttgttcca gggttgtaat tttaaacatc      3660
     gagaatactg t                                                           3671
//


spacer
spacer