Dbfetch

ID   AK053261; SV 1; linear; mRNA; HTC; MUS; 3970 BP.
XX
AC   AK053261;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130002N21 product:gamma-aminobutyric acid (GABA-A)
DE   transporter 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3970
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 25c86aadcd419c77a27044b41d51f7eb.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130002N21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3970
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130002N21"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1762
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-A) transporter 4
FT                   (MGD|MGI:95630 GB|L04662, evidence: BLASTN, 99%,
FT                   match=3968)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BKG0"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR002982"
FT                   /db_xref="MGI:MGI:95630"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BKG0"
FT                   /protein_id="BAC35326.1"
FT                   /translation="VHERGHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIP
FT                   YVVFFICCGIPVFFLETALGQFTSEGGITCWRRVCPLFEGIGYATQVIEAHLNVYYIII
FT                   LAWAIFYLSNCFTTELPWATCGHEWNTEKCVEFQKLNFSNYSHVSLQNATSPVMEFWER
FT                   RVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLIL
FT                   LIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNNYN
FT                   NNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGVPIAEVAESGPGLAFIAYPKAV
FT                   TMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDMYPKVFRRGYRRELLILALSI
FT                   ISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECVCIGWVYGSNRFYDNIEDMI
FT                   GYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNVYTYPAWGYGIGWLMALSSML
FT                   CIPLWIFIKLWKTEGTLPEKLQKLTVPSADLKMRGKLGASPRTVTVNDCEAKVKGDGTI
FT                   SAITEKETHF"
FT   regulatory      3946..3951
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3970
FT                   /note="putative"
XX
SQ   Sequence 3970 BP; 785 A; 1106 C; 993 G; 1086 T; 0 other;
     ggtccacgag cgcggccact ggaacaacaa ggtggagttc gtgttgagcg tagctggaga        60
     gatcatcgga ctgggcaacg tgtggcgctt tccctacctg tgctacaaaa acggcggagg       120
     ggcattcctg attccttacg tggtgttttt catctgctgc ggaatccccg tcttcttcct       180
     ggaaacggct ctggggcagt tcacgagcga gggtggcatc acgtgctgga ggagggtctg       240
     ccctttattt gaaggcattg gctatgcaac acaggtgatc gaggcacacc tcaatgtcta       300
     ctacatcatc atcctggcgt gggccatctt ctacctaagc aattgcttca ccaccgagct       360
     cccctgggcc acctgtgggc acgagtggaa cacagagaaa tgtgtggagt tccagaagct       420
     gaacttcagc aactacagtc atgtgtccct gcagaatgcc acctccccgg tcatggagtt       480
     ctgggaacgc cgggtcttgg ctatatccga tggcattgag cacattggga acctccgttg       540
     ggaactggca ttatgtctcc tggcggcctg gaccatctgc tacttctgca tatggaaggg       600
     tactaagtcg actggaaagg tcgtgtatgt cactgcaacc ttcccctaca tcatgctgct       660
     gatcctcctg atccgagggg tcacgttgcc aggcgcctct gaaggcatca agttctatct       720
     gtaccctgac ctctcccggc tctctgaccc acaggtgtgg gtggacgctg ggacgcagat       780
     ctttttctcc tatgccatct gcctgggctg cctaaccgct ctggggagtt acaacaacta       840
     taacaacaac tgctacaggg actgcattat gctctgctgt ctaaacagtg gcaccagctt       900
     cgtggctggg tttgccatct tctcagtcct gggcttcatg gcatacgagc agggtgtgcc       960
     tattgccgag gtggcagagt caggtcctgg actggctttc atcgcctacc ccaaggctgt      1020
     cactatgatg cccctctctc cactgtgggc caccttgttc ttcatgatgc tcatcttcct      1080
     gggcctggac agtcagtttg tgtgcgtgga gagtcttgtg acagccgtgg tagacatgta      1140
     ccctaaggtc ttccggcggg gctaccggcg agaactgctc atcctggccc tgtccatcat      1200
     ctcctatttc ctaggcctgg tgatgctgac cgagggaggc atgtacatct tccagctttt      1260
     tgactcatac gccgccagtg gcatgtgctt gctctttgtg gccatctttg agtgtgtctg      1320
     catcggctgg gtatatggaa gcaaccggtt ctatgacaat attgaggata tgattggtta      1380
     ccggccactg tcactcatca agtggtgctg gaaagtcgtg acccctggga tctgtgcggg      1440
     catcttcatc ttctttctgg tcaagtacaa accgctcaag tacaacaatg tgtacacata      1500
     tcctgcttgg ggctacggca tcggctggct catggctctg tcctccatgc tgtgtatccc      1560
     actctggatc ttcattaagc tgtggaagac agagggcaca ctgcccgaga aattacagaa      1620
     gttgacagtc cccagcgccg atctgaaaat gcggggcaag cttggggcca gcccacggac      1680
     ggtgaccgtt aatgactgtg aggccaaggt caagggcgac ggcaccatct ctgccatcac      1740
     agagaaggag acacacttct gagtccccac cagccatttg gatgcggctc caaccttcct      1800
     tccctgcgtg taaatgaatc ctgaacctcg tacttcacct aatgttaggg gcttgctcgt      1860
     ctgcacagga cttattaaca agttaactcc cagccggcca ctgtgtgccc tgtacccttg      1920
     cctcttccca gtgatagtgg gcatatccac ctcaccaaga taattctgta cagtgactag      1980
     cagatcctgg cctagggtgg ctcagccggt gttttctaga gtccttgtat tatatactgt      2040
     caactcgtat gctgggggca ggtggagtgg gggagcggtg cccatctgcc tctgatgttc      2100
     agtcattcct ggttttatct ctgaacttcc ctggccaccc tcctctgtgc cctgggacca      2160
     gtttgtttta ttttattttt ttttcttttg gtcttcccct tttcctagtg acaccttcca      2220
     catgtcaatg tcgtaagaca gagagcaaag cctcccacca tcgttaggac tcctgagtaa      2280
     ccaggagttg ctgactgtcc cttcaagtga ctgtggctcc tttctctccc tggcccctag      2340
     tttctccatc tcccagacca agggggcgag ggggttgagt ggagtcttcc cttcaaagca      2400
     gggaagaata cctgactcgt tgcttcgcag agctgctttg acctgcagag acttgtagac      2460
     ctcttctctt ctctgtcccc ttggttacca cctacccacc ttgcctattt taagtgaaac      2520
     ttaccaccaa tgatgtgggg aagtgtgttt ccctaacaac tggagtttta gcctaaccct      2580
     gatcccttaa ctggtgcacc ccagcccccg tgttcggggc tcccaccatc tgtccagcct      2640
     tcttggccac cagctctgtc cctccttcct agatagggat gatcagaagg tagccatctc      2700
     ttcttgcagc tgcctggcca ggatctatgg cttaggatct atggccaccc ctgcagggga      2760
     gctacagtga ggcctggggc tggattccac ccacagtccc ttccctgtgc accctgcttt      2820
     gtcccctgcc ttgtcccctg ctctctcttc tacctacctg cctacccctg cagatcctgt      2880
     gggcagacac cttactctgg agccattcca cctgcctgtc acctgggtct gagaagcctt      2940
     cacttccact tgccagaggg aagaactggc cacccatctg tcaggctctt ccttggaaac      3000
     gaagagcaga ggtggtctct agggggaggc tggtgccatt ccctcctgcc tggctcagac      3060
     ctcttagact ggtctctctt cctcagctgc tgggttcttt gtctgcccag ctattggagg      3120
     atgggaagtg gagggagggt cactctttcc ctcttactgt agtttcctag atttatctga      3180
     ggaaaagtga gatgtcttca cgctaaggct ccagtgttct gtcagagacc tgaatgctct      3240
     atttgcccaa tgcttccaga ctcttagctg ttctgcccag cccccgtccc gctcccacct      3300
     aaagcctgag ttggctgagc caaatgccca gcactgcccc cacctaactg ggcacttgtc      3360
     tagggcacac cacccccagc tgctcacaca cagaccacat attccttctg ggaaggccag      3420
     catcatcctg aagatgacct gtggggttgg tccttgatgg ctgtcccctc caccctaccc      3480
     ctgagaaggg aagctgcccg ttgctgctac tgcacctcac caccaactcc ctcatggaca      3540
     gacagatccc tgatgtctgt cactatagac acacgtgttg tacatgtggc ccttaacact      3600
     tgacactctt aacactactc atggggctgg gtagagggag gcttgtggtt tggggggttg      3660
     ttattttttg ctttcttttc ttcctttctt ttttcttttt gtcttttttt gtaatttcat      3720
     actagtattt gggtaactgt agggaggagg ggagggtaag tgggggcaag tgggggcaag      3780
     gggacatatc attgtgacaa cttttttgat atttactaga aatgatgcaa tatatccttt      3840
     ctgagatatt tacagtatta ttaaagggtt gggctgtttt gcataacaaa ctttttattg      3900
     gcatacccaa agagcacaag attgtctgtc tgctcgtttt taaaaattaa aggacgtgga      3960
     tcaactccct                                                             3970
//