Dbfetch

ID   AK053078; SV 1; linear; mRNA; HTC; MUS; 4069 BP.
XX
AC   AK053078;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 15 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:D930045G19 product:SODIUM- AND CHLORIDE-DEPENDENT GABA TRANSPORTER 3
DE   homolog [Rattus norvegicus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4069
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2ebaa486a1328de406c4b8d5e0525671.
DR   Ensembl-Gn; ENSMUSG00000030307; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031139; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031108; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030589; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031578; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030226; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030805; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030958; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030912; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031038; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030946; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031605; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029942; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030310; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032451; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079406; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079477; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0079400; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079420; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0077880; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0079896; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079628; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079005; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079042; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079190; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079047; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080144; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079055; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078150; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D930045G19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4069
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="15 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D930045G19"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             38..1921
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SODIUM- AND CHLORIDE-DEPENDENT GABA TRANSPORTER 3
FT                   homolog [Rattus norvegicus] (SWISSPROT|P31647, evidence:
FT                   FASTY, 99.5%ID, 100%length, match=1881)"
FT                   /note="putative"
FT                   /db_xref="GOA:P31650"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR002982"
FT                   /db_xref="MGI:MGI:95630"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31650"
FT                   /protein_id="BAC35259.1"
FT                   /translation="MTAEQALPLGNGKAAEEARGSETLGGGGGGAAGTREARDKAVHER
FT                   GHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETA
FT                   LGQFTSEGGITCWRRVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPW
FT                   ATCGHEWNTEKCVEFQKLNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWE
FT                   LALCLLAAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYL
FT                   YPDLSRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTS
FT                   FVAGFAIFSVLGFMAYEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLI
FT                   FLGLDSQFVCVESLVTAVVDMYPKVFRRGYRRELLILALSIISYFLGLVMLTEGGMYIF
FT                   QLFDSYAASGMCLLFVAIFECVCIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPG
FT                   ICAGIFIFFLVKYKPLKYNNVYTYPAWGYGIGWLMALSSMLCIPLWIFIKLWKTEGTLP
FT                   EKLQKLTVPSADLKMRGKLGASPRTVTVNDCEAKVKGDGTISAITEKETHF"
XX
SQ   Sequence 4069 BP; 789 A; 1138 C; 1067 G; 1075 T; 0 other;
     gagagccggg gccggcgcac gaggcggcag ggcggccatg actgcggagc aagcgctgcc        60
     cctgggcaac gggaaagcgg ccgaggaggc gcgggggtcc gagacgctgg gcggcggcgg       120
     cgggggcgcg gcggggacgc gcgaggcgcg cgacaaggct gtccacgagc gcggccactg       180
     gaacaacaag gtggagttcg tgttgagcgt agctggagag atcatcggac tgggcaacgt       240
     gtggcgcttt ccctacctgt gctacaaaaa cggcggaggg gcattcctga ttccttacgt       300
     ggtgtttttc atctgctgcg gaatccccgt cttcttcctg gaaacggctc tggggcagtt       360
     cacgagcgag ggtggcatca cgtgctggag gagggtctgc cctttatttg aaggcattgg       420
     ctatgcaaca caggtgatcg aggcacacct caatgtctac tacatcatca tcctggcgtg       480
     ggccatcttc tacctaagca attgcttcac caccgagctc ccctgggcca cctgtgggca       540
     cgagtggaac acagagaaat gtgtggagtt ccagaagctg aacttcagca actacagtca       600
     tgtgtccctg cagaatgcca cctccccggt catggagttc tgggaacgcc gggtcttggc       660
     tatatccgat ggcattgagc acattgggaa cctccgttgg gaactggcat tatgtctcct       720
     ggcggcctgg accatctgct acttctgcat atggaagggt actaagtcga ctggaaaggt       780
     cgtgtatgtc actgcaacct tcccctacat catgctgctg atcctcctga tccgaggggt       840
     cacgttgcca ggcgcctctg aaggcatcaa gttctatctg taccctgacc tctcccggct       900
     ctctgaccca caggtgtggg tggacgctgg gacgcagatc tttttctcct atgccatctg       960
     cctgggctgc ctaaccgctc tggggagtta caacaactat aacaacaact gctacaggga      1020
     ctgcattatg ctctgctgtc taaacagtgg caccagcttc gtggctgggt ttgccatctt      1080
     ctcagtcctg ggcttcatgg catacgagca gggtgtgcct attgccgagg tggcagagtc      1140
     aggtcctgga ctggctttca tcgcctaccc caaggctgtc actatgatgc ccctctctcc      1200
     actgtgggcc accttgttct tcatgatgct catcttcctg ggcctggaca gtcagtttgt      1260
     gtgcgtggag agtcttgtga cagccgtggt agacatgtac cctaaggtct tccggcgggg      1320
     ctaccggcga gaactgctca tcctggccct gtccatcatc tcctatttcc taggcctggt      1380
     gatgctgacc gagggaggca tgtacatctt ccagcttttt gactcatacg ccgccagtgg      1440
     catgtgcttg ctctttgtgg ccatctttga gtgtgtctgc atcggctggg tatatggaag      1500
     caaccggttc tatgacaata ttgaggatat gattggttac cggccactgt cactcatcaa      1560
     gtggtgctgg aaagtcgtga cccctgggat ctgtgcgggc atcttcatct tctttctggt      1620
     caagtacaaa ccgctcaagt acaacaatgt gtacacatat cctgcttggg gctacggcat      1680
     cggctggctc atggctctgt cctccatgct gtgtatccca ctctggatct tcattaagct      1740
     gtggaagaca gagggcacac tgcccgagaa attacagaag ttgacagtcc ccagcgccga      1800
     tctgaaaatg cggggcaagc ttggggccag cccacggacg gtgaccgtta atgactgtga      1860
     ggccaaggtc aagggcgacg gcaccatctc tgccatcaca gagaaggaga cacacttctg      1920
     agtccccacc agccatttgg atgcggctcc aaccttcctt ccctgcgtgt aaatgaatcc      1980
     tgaacctcgt acttcaccta atgttagggg cttgctcgtc tgcacaggac ttattaacaa      2040
     gttaactccc agccggccac tgtgtgccct gtacccttgc ctcttcccag tgatagtggg      2100
     catatccacc tcaccaagat aattctgtac agtgactagc agatcctggc ctagggtggc      2160
     tcagccggtg ttttctagag tccttgtatt atatactgtc aactcgtatg ctgggggcag      2220
     gtggagtggg ggagcggtgc ccatctgcct ctgatgttca gtcattcctg gttttatctc      2280
     tgaacttccc tggccaccct cctctgtgcc ctgggaccag tttgttttat tttatttttt      2340
     tttcttttgg tcttcccctt ttcctagtga caccttccac atgtcaatgt cgtaagacag      2400
     agagcaaagc ctcccaccat cgttaggact cctgagtaac caggagttgc tgactgtccc      2460
     ttcaagtgac tgtggctcct ttctctccct ggcccctagt ttctccatct cccagaccaa      2520
     gggggcgagg gggttgagtg gagtcttccc ttcaaagcag ggaagaatac ctgactcgtt      2580
     gcttcgcaga gctgctttga cctgcagaga cttgtagacc tcttctcttc tctgtcccct      2640
     tggttaccac ctacccacct tgcctatttt aagtgaaact taccaccaat gatgtgggga      2700
     agtgtgtttc cctaacaact ggagttttag cctaaccctg atcccttaac tggtgcaccc      2760
     cagcccccgt gttcggggct cccaccatct gtccagcctt cttggccacc agctctgtcc      2820
     ctccttccta gatagggatg atcagaaggt agccatctct tcttgcagct gcctggccag      2880
     gatctatggc ttaggatcta tggccacccc tgcaggggag ctacagtgag gcctggggct      2940
     ggattccacc cacagtccct tccctgtgca ccctgctttg tcccctgcct tgtcccctgc      3000
     tctctcttct acctacctgc ctacccctgc agatcctgtg ggcagacacc ttactctgga      3060
     gccattccac ctgcctgtca cctgggtctg agaagccttc acttccactt gccagaggga      3120
     agaactggcc acccatctgt caggctcttc cttggaaacg aagagcagag gtggtctcta      3180
     gggggaggct ggtgccattc cctcctgcct ggctcagacc tcttagactg gtctctcttc      3240
     ctcagctggt gggttctttg tctgcccagc tattggagga tgggaagtgg agggagggtc      3300
     actctttccc tcttactgta gtttcctaga tttatctgag gaaaagtgag atgtcttcac      3360
     gctaaggctc cagtgttctg gtcagagacc tgaatgctct atttgcccaa tgcttccaga      3420
     ctcttagctg ttctgcccag cccccgtccc gctcccacgt aaagcctgag ttggctgagc      3480
     caaatgccca gcactgcccc cacctaactg ggcacttgtg tagggcacac cacccccagc      3540
     tgctcacaca cagaccacat attccttctg ggaagggcca gcatcatcct gaagatgacc      3600
     tgtggggttg gtccttgatg gctgtcccct ccaccctacc cctgagaagg gaagctgccc      3660
     gttgctgcta ctgcacctca ccaccaactc cctcatggac agacagatcc ctgatgtctg      3720
     tcactataga cacacgtgtt gtacatgtgg cccttaacac ttgacactct taacactact      3780
     catggggctg ggtagaggga ggcttgtggt ttggggggtt gttatttttt gctttctttt      3840
     cttcctttct tttttctttt tgtctttttt tgtaatttca tactagtatt tgggtaactg      3900
     tagggaggag gggagggtaa gtgggggcaa gtgggggcaa ggggacatat cattgtgaca      3960
     acttttttga tatttactag aaatgatgca atatatcctt tctgagatat ttacagtatt      4020
     attaaagggt tgggctgttt tgcataacaa actttttatt ggcataccc                  4069
//