Dbfetch

ID   AK052950; SV 1; linear; mRNA; HTC; MUS; 2203 BP.
XX
AC   AK052950;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 15 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:D930002J18 product:FRIZZLED 10 PRECURSOR (FRIZZLED-10) (FZ-10)
DE   (HFZ10) (FZE7) homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2203
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e049c0ac497865804f2605c66e81da43.
DR   Ensembl-Gn; ENSMUSG00000081683; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030086; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030096; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030549; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029783; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029933; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029889; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030022; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030590; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028936; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029296; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000117102; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0074568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0074647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0074550; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0074587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074219; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0075055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0074768; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0074170; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0074309; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0074212; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0074369; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074216; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075288; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0073344; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D930002J18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2203
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="15 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D930002J18"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             376..2124
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="FRIZZLED 10 PRECURSOR (FRIZZLED-10) (FZ-10) (HFZ10)
FT                   (FZE7) homolog [Homo sapiens] (SWISSPROT|Q9ULW2, evidence:
FT                   FASTY, 92.8%ID, 100%length, match=1746)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BKG4"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026549"
FT                   /db_xref="InterPro:IPR036790"
FT                   /db_xref="MGI:MGI:2136761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BKG4"
FT                   /protein_id="BAC35217.1"
FT                   /translation="MQHPGPRLWLVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKD
FT                   IGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPI
FT                   PACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGS
FT                   GMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSR
FT                   DDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIR
FT                   LFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAG
FT                   KKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFV
FT                   LVPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATC
FT                   VIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGI
FT                   TSGVWVWTSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPA
FT                   QPSACV"
XX
SQ   Sequence 2203 BP; 409 A; 687 C; 674 G; 433 T; 0 other;
     ttcccgggac gccgtgctgg aagcagctgc gggcgccggg agggaggagc tccagggccc        60
     agggccacgg tgtgcccgcg ctgccccacc gcggtccgcg atcgcccgcg cccggaagaa       120
     gaggccaaag tttgcgcgct gagcggcgct cgctccgccg tattgtttgc aaacttcgct       180
     cccctccccc gccgcccccc gactccgctg aggccgcgcg cccaccgcgg tggccccggg       240
     cgccgcgagc gctccggcca gactggatgg gcatgcgcgg gggcccgagc cggggcgcgg       300
     agccgcgggc agcagcaaca gcccgtgccc gggagcggcg gccctgagcg gcgctgggac       360
     attgagggcg ccaccatgca acacccgggc ccgcgcctgt ggctggtgct gcaggtgatg       420
     ataggctcgt gcacggccat cagctccatg gacttagagc gccctggaga cggcaagtgc       480
     cagccggtgg agattcccat gtgcaaggac atcggctaca acaccacccg catgcccaac       540
     ctgatgggtc acgagaacca gcgcgaggcg gccatccaac tgcacgagtt cgcgccgctc       600
     gtggagtacg gctgccacag ccaccttcgc ttcttcctgt gttcgctgta cgcgcccatg       660
     tgcaccgagc aggtctccac acccatccct gcttgccggg tcatgtgcga gcaggcccgg       720
     ctcaagtgct cgccgatcat ggagcagttc aaattcaggt ggccggactc cctggattgc       780
     agcaagctcc ccaacaagaa cgaccccaac tacctgtgca tggaggcacc caacaacggc       840
     tcggatgagc ccagccgggg ctctggcatg tttcctccgc tcttcaggcc ccagaggccc       900
     cacagcgcgc aggagcaccc actaaaggac gggggtccgg ggcgcgcagg ttgtgacaac       960
     ccaggcaagt tccaccatgt ggagaagagc gaatcttgcg caccgctttg cactccgggg      1020
     gtggatgtgt attggagccg cgacgacaag cgcttcgctg tggtctggct ggccatctgg      1080
     tccgtgctgt gcttcttctc cagcgccttc accgtgctca ccttcctcat cgacccatcg      1140
     cgcttcaggt accccgaacg tcctatcatc ttcctctcca tgtgctactg cgtttattcg      1200
     gtgggctata tcatccgcct cttcgcgggc gcggagagca tcgcttgtga ccgggacagt      1260
     gggcagctgt atgttatcca ggaaggactg gagagcacgg gctgtacctt agtcttcttg      1320
     gtactttact acttcggcat ggccagctct ttatggtggg tggtcctcac cctcacttgg      1380
     ttcctggctg ctggaaagaa gtggggccat gaggccattg aagccaacag cagctacttt      1440
     cacctggcag cttgggccat cccggctgtg aagactatct tgatcttggt gatgcgcagg      1500
     gtggcagggg atgagctcac tggtgtgtgt tatgtgggca gcatggatgt caatgctctg      1560
     accggcttcg tgctggtccc gctggcttgc tacctagtca tcggcacttc cttcatcctg      1620
     tccggctttg tggctttatt ccacatccgg agggtgatga aaacgggtgg ggagaacacg      1680
     gacaagctgg agaagctcat ggtacgcata ggggtcttct ccctcctcta cactgtgccg      1740
     gccacctgtg tgattgcctg ctatttttat gaacgcctca acatggacta ctggaagatg      1800
     ctggccaccc agcacaagtg taagatgaac aatcagacca agacacctga ctgcctgatg      1860
     accacctcca tccctgccgt ggaggtcttc atggtcaaag tgtccatgct gctggtggtg      1920
     ggcatcacca gtggggtgtg ggtctggact tccaagaccc tgcagtcctg gcaacacgta      1980
     tgcagccggg ggctaaagag aaaaagccgg aggaaaccag ccagtgtggt caccagtgca      2040
     gggatctaca aaaaagccca gcacccccaa aaacctcacc ttgggaagta tgaactgccc      2100
     gcccagcctt cagcctgcgt gtgaaggcag agctggctgc aagaacagga cattcggagc      2160
     ccaaatgggc agcttttctt ggttggctgg ttgttggtaa atc                        2203
//