Dbfetch

ID   AK052947; SV 1; linear; mRNA; HTC; MUS; 2765 BP.
XX
AC   AK052947;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 15 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:D930001M08 product:FALLOTEIN (PLATELET-DERIVED GROWTH FACTOR C)
DE   homolog [Mus musculus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2765
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e7465a8d9347aa7c0b8081531dc2eb02.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027321; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027283; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027251; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027294; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027038; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027740; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026485; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027013; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027149; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027117; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027257; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027798; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026219; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026563; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061298; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0061321; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0061259; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061247; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060944; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061726; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061236; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0060918; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0061011; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0060997; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0061152; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060963; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061911; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060788; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060214; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D930001M08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2765
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="15 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D930001M08"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             274..1311
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="FALLOTEIN (PLATELET-DERIVED GROWTH FACTOR C) homolog
FT                   [Mus musculus] (SPTR|Q9QY71, evidence: FASTY, 100%ID,
FT                   100%length, match=1035)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="InterPro:IPR029817"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CI19"
FT                   /protein_id="BAC35216.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
FT   regulatory      2738..2743
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2765
FT                   /note="putative"
XX
SQ   Sequence 2765 BP; 766 A; 593 C; 635 G; 771 T; 0 other;
     ggcacttcgg cacagctcag gatttgttta aaccttggga aactggttca ggtccaggtt        60
     ttgctttgat ccttttcaaa aactggagac acagaagagg gctctaggaa aaacttttgg       120
     atgggattat gtggaaacta ccctgcgatt ctctgctgcc agagccggcc aggcgcttcc       180
     accgcagcgc agcctttccc cggctgggct gagccttgga gtcgtcgctt ccccagtgcc       240
     cgccgcgagt gagccctcgc cccagtcagc caaatgctcc tcctcggcct cctcctgctg       300
     acatctgccc tggccggcca aagaacgggg actcgggctg agtccaacct gagcagcaag       360
     ttgcagctct ccagcgacaa ggaacagaac ggagtgcaag atccccggca tgagagagtt       420
     gtcactatat ctggtaatgg gagcatccac agcccgaagt ttcctcatac atacccaaga       480
     aatatggtgc tggtgtggag attagttgca gtagatgaaa atgtgcggat ccagctgaca       540
     tttgatgaga gatttgggct ggaagatcca gaagacgata tatgcaagta tgattttgta       600
     gaagttgagg agcccagtga tggaagtgtt ttaggacgct ggtgtggttc tgggactgtg       660
     ccaggaaagc agacttctaa aggaaatcat atcaggataa gatttgtatc tgatgagtat       720
     tttccatctg aacccggatt ctgcatccac tacagtatta tcatgccaca agtcacagaa       780
     accacgagtc cttcggtgtt gcccccttca tctttgtcat tggacctgct caacaatgct       840
     gtgactgcct tcagtacctt ggaagagctg attcggtacc tagagccaga tcgatggcag       900
     gtggacttgg acagcctcta caagccaaca tggcagcttt tgggcaaggc tttcctgtat       960
     gggaaaaaaa gcaaagtggt gaatctgaat ctcctcaagg aagaggtaaa actctacagc      1020
     tgcacacccc ggaacttctc agtgtccata cgggaagagc taaagaggac agataccata      1080
     ttctggccag gttgtctcct ggtcaagcgc tgtggaggaa attgtgcctg ttgtctccat      1140
     aattgcaatg aatgtcagtg tgtcccacgt aaagttacaa aaaagtacca tgaggtcctt      1200
     cagttgagac caaaaactgg agtcaaggga ttgcataagt cactcactga tgtggctctg      1260
     gaacaccacg aggaatgtga ctgtgtgtgt agaggaaacg caggagggta actgcagcct      1320
     tcgtagcagc acacgtgagc actggcattc tgtgtacccc cacaagcaac cttcatcccc      1380
     accagcgttg gccgcagggc tctcagctgc tgatgctggc tatggtaaag atcttactcg      1440
     tctccaacca aattctcagt tgtttgcttc aatagccttc ccctgcagga cttcaagtgt      1500
     cttctaaaag accagaggca ccaagaggag tcaatcacaa agcactgcct tctagaggaa      1560
     gcccagacaa tggtcttctg accacagaaa caaatgaaat gaatgtagat cgctagcaaa      1620
     ctctggagtg acagcatttc ttttccactg acagaatggt gtagcttagt tgtcttgata      1680
     tgggcaagtg atgtcagcac aagaaaatgg tgaaaaacac acacttgatt gtgaacaatg      1740
     cagaaatact tggatttctc caacctgttt gcatagatag acagatgctc tgttttctac      1800
     aaactcaaag cttttagaga gcagctatgt taataggaat taaatgtgcc atgctgaaag      1860
     gaaagactga agttttcaat gcttggcaac ttctccgcaa tttggaggaa aggtgcggtc      1920
     atggtttgga gaaagcacac ctgcacagag gagtggcctt cccttccctt ccctctgagg      1980
     tggcttctgt gtttcattgt gtatattttt atattctcct tttgacatta taactgttgg      2040
     cttttctaat cttgttaaat atttctattt ttaccaaagg tatttaatat tcttttttat      2100
     gacaacctag agcaattatt tttagcttga taattttttt ttctaaacaa aattgttata      2160
     gccagaagaa caaagatgat tgatataaaa atcttgttgc tctgacaaaa acatatgtat      2220
     ttcttccttg tatggtgcta gagcttagcg tcatctgcat ttgaaaagat ggaatgggga      2280
     agtttttaga attggtaggt cgcagggaca gtttgataac aactgtacta tcatcaattc      2340
     ccaattctgt tcttagagct acgaacagaa cagagcttga gtaaatatgg agccattgct      2400
     aacctacccc tttctatggg aaataggagt atagctcaga gaagcacgtc cccagaaacc      2460
     tcgaccattt ctaggcacag tgttctgggc tatgctgcgc tgtatggaca tatcctattt      2520
     atttcaatac tagggtttta ttacctttaa actctgctcc atacacttgt attaatacat      2580
     ggatattttt atgtacagaa gtatatcatt taaggagttc acttattata ctctttggca      2640
     attgcaaaga aaatcaacat aatacattgc ttgtaaatgc ttaatctgtg cccaagtttt      2700
     gtggtgacta tttgaattaa aatgtattga atcatcaaat aaaataatct ggctattttg      2760
     ggggc                                                                  2765
//