spacer

EBI Dbfetch

ID   AK052685; SV 1; linear; mRNA; HTC; MUS; 1419 BP.
XX
AC   AK052685;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 0 day neonate kidney cDNA, RIKEN full-length enriched library,
DE   clone:D630023D24 product:renin 1 structural, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1419
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ec926f0910dec68dc5cf474f21b48754.
DR   Ensembl-Gn; ENSMUSG00000070645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094556; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D630023D24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1419
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D630023D24"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             33..1241
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="renin 1 structural (MGD|MGI:97898 GB|NM_031192,
FT                   evidence: BLASTN, 100%, match=1400)"
FT                   /db_xref="GOA:P06281"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012848"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="MGI:MGI:97898"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06281"
FT                   /protein_id="BAC35094.1"
FT                   /translation="MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILE
FT                   ERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTG
FT                   SANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTV
FT                   GGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVF
FT                   SVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEG
FT                   CAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYT
FT                   LSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFA
FT                   LAR"
FT   polyA_signal    1403..1408
FT                   /note="putative"
FT   polyA_site      1419
FT                   /note="putative"
XX
SQ   Sequence 1419 BP; 313 A; 416 C; 365 G; 325 T; 0 other;
     acacagctct tagaaagcct tggctgaacc agatggacag aaggaggatg cctctctggg        60
     cactcttgtt gctctggagt ccttgcacct tcagtctccc aacacgcacc gctacctttg       120
     aacgaatccc gctcaagaaa atgccttctg tccgggaaat cctggaggag cggggagtgg       180
     acatgaccag gctcagtgct gaatggggcg tattcacaaa gaggccttcc ttgaccaatc       240
     ttacctcccc cgtggtcctc accaactacc tgaataccca gtactacggc gagattggca       300
     tcggtacccc accccagacc ttcaaagtca tctttgacac gggttcagcc aacctctggg       360
     tgccctccac caagtgcagc cgcctctacc ttgcttgtgg gattcacagc ctctatgagt       420
     cctctgactc ctccagctac atggagaacg ggtccgactt caccatccac tacggatcag       480
     ggagagtcaa aggtttcctc agccaggact cggtgactgt gggtggaatc actgtgacac       540
     agacctttgg agaggtcacc gagctgcccc tgatcccttt catgctggcc aagtttgacg       600
     gtgttctagg catgggcttt cccgctcagg ccgttggcgg ggttacccct gtctttgacc       660
     acattctctc ccagggggtg ctaaaggagg aagtgttctc tgtctactac aacaggggtt       720
     cccacctgct ggggggcgag gtggtgctag gaggtagcga cccgcagcat tatcaaggca       780
     attttcacta tgtgagcatc agcaagactg actcctggca gatcacgatg aagggggtgt       840
     ctgtggggtc ttccaccctg ctatgtgaag aaggctgtgc ggtagtggtg gacactggtt       900
     catcctttat ctcggctcct acgagctccc tgaagttgat catgcaagcc ctgggagcca       960
     aggagaagag aatagaagaa tatgttgtga actgtagcca ggtgcccacc ctccccgaca      1020
     tttcctttga cctgggaggc agggcctaca cactcagcag tacggactac gtgctacagt      1080
     atcccaacag gagagacaag ctgtgcacac tggctctcca tgccatggac atcccaccac      1140
     ccactgggcc tgtctgggtc ctgggtgcca ccttcatccg caagttctat acagagtttg      1200
     atcggcataa caatcgcatt ggattcgcct tggcccgcta aggccctctg ccacccagta      1260
     accctaggcc aagccaagct ggcagtcctg ggggccattt tgtctggctt tgtccccaac      1320
     atagggacac tggacacaga gaccctaacg agtgtttgcc ccttcacctg cactcaccct      1380
     tccctgcttt aaggaaaaat cgaataaaga tttcatgtc                             1419
//


spacer
spacer