spacer

EBI Dbfetch

ID   AK052591; SV 1; linear; mRNA; HTC; MUS; 2898 BP.
XX
AC   AK052591;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate kidney cDNA, RIKEN full-length enriched library,
DE   clone:D630001M17 product:hypothetical Ankyrin repeat/ARM repeat structure
DE   containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2898
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1b5a19d2fd2b9189dc13aa12a45fb0bc.
DR   Ensembl-Gn; ENSMUSG00000036273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060642; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D630001M17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2898
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D630001M17"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             59..>2898
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Ankyrin repeat/ARM repeat structure
FT                   containing protein (SCOP|48403 SCOP|48371, evidence: SCOP)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5S006"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1913975"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S006"
FT                   /protein_id="BAC35052.1"
FT                   /translation="MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDML
FT                   VFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGP
FT                   QDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFL
FT                   LIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKE
FT                   IVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTL
FT                   GNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQ
FT                   SEKEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPA
FT                   HREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAP
FT                   EVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPG
FT                   LLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDA
FT                   TETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTL
FT                   QRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNL
FT                   CCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKES
FT                   SPKLVELLLNGGCREQDVRKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGK
FT                   IDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGKFSEDALAK
FT                   FGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRCSPNAQ
FT                   RHSNSLGPVFDHEDLL"
XX
SQ   Sequence 2898 BP; 782 A; 641 C; 745 G; 730 T; 0 other;
     ggagcagctc tgagagcagg agccgtccca gctcgccgca gtccccgccg gctgcaccat        60
     ggccagtggc gcctgtcagg gctgcgaaga ggaagaggag gaggaggctc tgaagaagtt       120
     gatagtcagg ctgaataatg tccaggaagg caagcagatc gagacgttgc ttcagctcct       180
     ggaggacatg ctggtgttca cctactcgga ccgcgcctcc aagttatttg aagataaaaa       240
     tttccacgtg cctctgttga ttgtcctgga ctcctacatg agagttgcca gtgtacagca       300
     ggcggggtgg tcacttctgt gcaaattaat agaagtctgt ccagggacat tgcaaagctt       360
     aataggaccc caggatattg gaaatgattg ggaagtcctt ggtattcacc ggctgattct       420
     taaaatgtta actgttcatc acgccaatgt aaacctgtca atagttggac taaaagcctt       480
     ggatctcctc ctagattcag gtaaactcac cttgctgata ctggatgaag aatgtgatat       540
     tttcttgtta atttttgatg ccatgcacag atattcagcc aatgatgaag tccaaaaact       600
     gggatgcaaa gctttacacg tgctttttga gagagtttcc gaggaacagc tgactgagtt       660
     tgtggagaac aaagattaca cgatactgct gagtacgttc ggcagcttca gaagggacaa       720
     ggagattgtg taccacgtac tttgctgctt gcattccctg gcggttacat gcagcaatgt       780
     agaggtcctc atgagtggga atgtccggtg ctacaatctt gtggtggagg ccatgaaagc       840
     cttccccacc aatgaaaaca tccaagaggt gagctgctcc ttgttccaga agcttacatt       900
     aggtaacttt ttcaacatcc tggtgttgaa cgaagtgcat gtctttgtgg tgaaagcggt       960
     ccgacagtat cctgagaacg cagccttaca gatctctgca ctcagctgtt tagcactcct      1020
     cactgagact attttcttaa accaagactt ggaggaaaga agtgagactc aagagcagag      1080
     cgaaaaggaa gacagtgaga agcttttctg gctggaaccc tgctataaag ccctggtgcg      1140
     ccatcgaaag gacaaacacg tgcaggaggc tgcctgctgg gcactaaata acctccttat      1200
     gtaccagaac agtttgcatg agaagatcgg agatgaagat ggccagttcc ctgcgcacag      1260
     ggaagtgatg ctgtctatgc tgatgcactc ttcttccaaa gatgtcttcc aagcagctgc      1320
     acatgctctg tccactctct tggaacaaaa tgttaatttc aggaaaatcc tgctggcaaa      1380
     aggagtatac ctgaatgtct tggaattgat gcagaagcat gcccatgcgc ctgaggtggc      1440
     agagagtggc tgcaagatgc tgagtcacct gtttgaagga agtaaccctt ctctggatac      1500
     aatggcagca gtggtcccta aaatactaac agtgatgaaa gcccacggaa cgtctctgtc      1560
     agtccagctg gaggcgctgc gagctatctt gcatttcgtt gtgccaggac tattggaaga      1620
     atccagggag gactctcaat gcagaccaaa tgtgctcaga aaacagtgtt tcaggactga      1680
     catccacaag ctggttctag tcgctctgaa caggttcatt gggaatcctg ggattcagaa      1740
     atgtggattg aaagtaatct cttctctcgc gcaccttcct gatgccacag agacattgtc      1800
     cctgcaagga gcagttgact cagtcctcca caccttacag atgtatccag atgaccaaga      1860
     aattcagtgt ctgggcttac accttatggg atgcttgatg acaaagaaga atttctgcat      1920
     agggacaggg cacctcctgg caaaaattct ggcttccact ttgcagcgct ttaaagatgt      1980
     tgctgaggtg cagactacag gattacagac aaccctgtca atacttgagc tgtcagtatc      2040
     tttctccaag ctgctagtgc actattcctt tgatgtggtg atatttcatc agatgtcttc      2100
     cagtgttgta gaacaaaagg atgagcagtt cctcaatcta tgttgcaaat gctttgcaaa      2160
     agtggccgtg gatgatgagc tgaaaaacac catgctagag agagcctgcg atcagaataa      2220
     cagcatcatg gttgaatgtt tgctcctctt gggagctgat gccaaccaag tgaagggggc      2280
     aacttcttta atctatcagg tatgtgagaa agagagcagt cctaaattgg tggaactgtt      2340
     gcttaatggt ggttgtcgtg aacaagatgt acggaaggcc ctgaccgtaa gcatccaaaa      2400
     gggcgacagc caggtcatca gcttgctcct caggaaactt gccctggacc tggccaacaa      2460
     cagcatttgc cttggaggat ttggcatagg aaaaattgat ccttcttggc ttggtccttt      2520
     atttccagat aagtcatcca atttaaggaa gcaaacaaac acaggatctg tcctagcgag      2580
     gaaagtgctc cggtatcaga tgagaaacac ccttcaagaa ggcgtggcct caggcagtga      2640
     cggcaagttt tctgaagacg cgctggcgaa atttggagaa tggaccttta ttcccgactc      2700
     ttctatggac agtgtgtttg gccagagcga tgatctggat agcgaaggca gcgagagctc      2760
     atttctcgtg aagaggaagt ccaactcaat tagtgtaggg gaagtttaca gagatctagc      2820
     tctgcagcgc tgctcaccaa atgctcagag gcattccaat tcgctgggtc ctgtttttga      2880
     ccatgaagac ttactgag                                                    2898
//


spacer
spacer