Dbfetch

ID   AK052448; SV 1; linear; mRNA; HTC; MUS; 938 BP.
XX
AC   AK052448;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 13 days embryo lung cDNA, RIKEN full-length enriched library,
DE   clone:D430025B14 product:amyloid beta (A4) precursor protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-938
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1294fb992a2316a0dd9154c8cf41acca.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D430025B14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..938
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D430025B14"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..658
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="amyloid beta (A4) precursor protein (MGD|MGI:88059
FT                   GB|NM_007471, evidence: BLASTN, 100%, match=763)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BPV5"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BPV5"
FT                   /protein_id="BAC34997.1"
FT                   /translation="AVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSL
FT                   TETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGS
FT                   GLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATV
FT                   IVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN"
XX
SQ   Sequence 938 BP; 254 A; 235 C; 231 G; 218 T; 0 other;
     tgcggtggct gaggagattc aagatgaagt cgatgagctg cttcagaagg agcagaacta        60
     ctccgacgat gtcttggcca acatgatcag tgagcccaga atcagctacg gaaacgacgc       120
     tctcatgcct tcgctgacgg aaaccaagac caccgtggag ctccttcccg tgaatgggga       180
     attcagcctg gatgacctcc agccgtggca cccttttggg gtggactctg tgccagccaa       240
     taccgaaaat gaagtcgagc ctgttgacgc ccgccccgct gctgaccgag gactgaccac       300
     tcgaccaggt tctgggctga caaacatcaa gacggaagag atctcggaag tgaagatgga       360
     tgcagaattc ggacatgatt caggatttga agtccgccat caaaaactgg tgttctttgc       420
     tgaagatgtg ggttcgaaca aaggcgccat catcggactc atggtgggcg gcgttgtcat       480
     agcaaccgtg attgtcatca ccctggtgat gttgaagaag aaacagtaca catccatcca       540
     tcatggcgtg gtggaggtcg acgccgccgt gaccccagag gagcgccatc tctccaagat       600
     gcagcagaac ggatatgaga atccaactta caagttcttt gagcaaatgc agaactaagc       660
     cccacccgcg ccacagcagc ggcctctgaa cttggacagc gaaaccattg cttcactacc       720
     catcggtgtt catttataaa ataacgtgga aagaaacaaa cccttccgtt tatttactca       780
     ccctcggctt ttgacagctg tgctgtaaca caagtagatg cctgaacttg aattaatata       840
     cgaatcagta atgtattctc gctttctctc tttacattct ggtctctaca ttacatgatt       900
     catgggtttt gtgtactgta aaaaaaaaaa ttagctgc                               938
//