spacer

EBI Dbfetch

ID   AK052348; SV 1; linear; mRNA; HTC; MUS; 1128 BP.
XX
AC   AK052348;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 13 days embryo heart cDNA, RIKEN full-length enriched library,
DE   clone:D330035H02 product:heparan sulfate 6-O-sulfotransferase 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1128
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 26fda93e6404150e552a88c89e2d394c.
DR   Ensembl-Gn; ENSMUSG00000062184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114871; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D330035H02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1128
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D330035H02"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             72..>1128
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="heparan sulfate 6-O-sulfotransferase 2
FT                   (MGD|MGI:1354959 GB|NM_015819, evidence: BLASTN, 100%,
FT                   match=911)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q80UW0"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR010635"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1354959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UW0"
FT                   /protein_id="BAC34950.1"
FT                   /translation="MHDLRRRWDLGSLCRALLTRGLAAVGHSLKHVLSAIFSKIFGPLA
FT                   SVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESS
FT                   ARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRV
FT                   GQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRDARLRPSRWRI
FT                   FQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGKNFHYITILRDPVSRYLSEWRHV
FT                   QRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLANNRQVRMLSDL
FT                   TLVGCYNLSVMP"
XX
SQ   Sequence 1128 BP; 222 A; 342 C; 325 G; 239 T; 0 other;
     gattttcttc cttggcggga gccttgcgcg ccccgctctt cgcgctgctg cctcgaggcc        60
     gccgcaggcg gatgcacgac ctcaggcgac gctgggacct gggctccctc tgccgggccc       120
     tgctcactcg gggcctggca gccgtgggcc actcgctcaa gcacgtgctc agtgcgatct       180
     tctccaagat tttcggtccc ttggccagcg tcgggaacat ggatgagaaa tctaacaagc       240
     tgctgctggc tttggtgatg ctcttcctat ttgcggtgat cgtcctccaa tacgtgtgcc       300
     ccggcacaga atgccagctc ctccgcctgc aggcgttcag ctccccggtg ccggatccgt       360
     accgctcgga ggatgagagt tcggccaggt ttgtaccccg ctacaatttc agccgcggcg       420
     atctcctgcg caaggtagac ttcgacatca agggcgatga cctgatcgtg ttcctgcaca       480
     tccagaagac tgggggcacc acttttggcc gtcacctggt gcgcaacatc cagctggagc       540
     agccatgtga gtgccgcgtg gggcagaaga aatgcacttg ccaccggccg ggtaagaggg       600
     agacctggct cttctccagg ttctccaccg gctggagctg cgggctgcat gccgactgga       660
     ccgagctcac cagctgcgtg ccggcggtgg tggatggcaa gcgcgacgcc aggctgagac       720
     cttccaggtg gaggattttt cagattctag atggaacaag taaggataga tggggttctt       780
     caaacttcaa ctcaggcgcc aactctccat cctccacaaa gccccggagc acatcgaaga       840
     gtgggaagaa cttccattac attaccatcc tgagagaccc agtgtcacgg tacttgagtg       900
     aatggaggca tgtccagaga ggagcaactt ggaaagcatc cctgcacgtc tgtgatggaa       960
     ggcccccaac ctctgaagag ctgcccagct gctacaccgg tgatgactgg tctggatgcc      1020
     ctctcaaaga gttcatggac tgtccctata atctggccaa caaccgccaa gttcgcatgc      1080
     tatctgacct gactctagtg ggatgctaca acctctctgt catgcctg                   1128
//


spacer
spacer