spacer

EBI Dbfetch

ID   AK051390; SV 1; linear; mRNA; HTC; MUS; 3100 BP.
XX
AC   AK051390;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 12 days embryo spinal ganglion cDNA, RIKEN full-length
DE   enriched library, clone:D130045I15 product:myotubularin related protein 1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3100
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 880735915d80682ad722315641c71ae5.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015358; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D130045I15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3100
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D130045I15"
FT                   /tissue_type="spinal ganglion"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1163
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="myotubularin related protein 1 (MGD|MGI:1858271
FT                   GB|NM_016985, evidence: BLASTN, 99%, match=3100)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8BQ73"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BQ73"
FT                   /protein_id="BAC34622.1"
FT                   /translation="AAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYL
FT                   QTIMDANAQSHKLTIFDARQNSVADTNKAKGGGYENESAYPNAELIFLEIHNIHVMRES
FT                   LRKLKEIVYPSIDESHWLSNVDGTHWLEYIRVLLAGAVRIADKIESGKTSVVIHCSDGW
FT                   DRTSQLTSLAMLMLDSYYRTIKGFEALIEKEWISFGHRFALRVGHGDDNHADADRSPIF
FT                   LQFIDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRIKEDVYTNTIS
FT                   LWSYINSQLDEFSNPFFVNYENHVLYPVASMSHLELWVNYYVRWNPRMRPQMPIHQNLK
FT                   ELLAIKAELQKRVEDLQREMATRTISSSSERGSSPTHSATPVHTSV"
XX
SQ   Sequence 3100 BP; 841 A; 669 C; 651 G; 939 T; 0 other;
     tggcagcctt tcgagcgaaa ggcagagtcc ctgtgttgtc atggattcac ccagaaagtc        60
     aggcaacaat tacacgttgc agccagccat tagtgggtcc caatgataaa cgctgcaaag       120
     aagatgagaa atacctgcag acaataatgg atgctaatgc acagtcacat aaacttacta       180
     tctttgatgc cagacaaaac agcgttgctg ataccaacaa ggcaaagggt ggtggatatg       240
     aaaatgaaag tgcttaccct aatgccgaac tcatattctt ggagatccac aatattcatg       300
     tgatgaggga gtcacttcgt aaattaaagg agattgtgta tccttcaatt gatgagtcac       360
     attggctatc caatgtggat gggacacatt ggctggaata tatacgggtt ctccttgctg       420
     gggcagtgag aattgctgat aaaatagaat ctgggaaaac ttccgtggtc atccactgca       480
     gtgatgggtg ggatcgaaca tcccagctca catctctggc aatgctgatg ttagacagtt       540
     attaccggac cattaaagga tttgaggctc tcatagaaaa ggagtggata agctttggac       600
     acaggtttgc cctgagagtg ggccatggtg atgacaacca tgcagatgct gaccgatcac       660
     ctatatttct tcagtttatt gattgtgttt ggcagatgac aagacagttc ccttcagcat       720
     ttgagtttaa tgaattattc ttgattacaa ttttggatca cctctatagt tgtctttttg       780
     ggaccttttt gtgcaactgt gaacaacagc gaatcaaaga ggatgtatat acaaatacta       840
     tatctttatg gtcttatatc aatagccaac tagatgaatt ctcaaatccc ttctttgtga       900
     attatgagaa ccatgtgtta tatcctgttg ctagtatgag tcacttggaa ttgtgggtaa       960
     attattatgt acggtggaat ccacggatga gaccacagat gccaattcat cagaatctca      1020
     aggaactgct ggctatcaag gctgagctgc agaagcgtgt ggaggacttg cagcgggaga      1080
     tggccacccg gaccatctca tcttcctctg agaggggctc ctcacctacc cactcagcta      1140
     ctcctgtaca cacctcagtc tgatgaacaa agccagtacc ccgggccatc cggctgctct      1200
     attgtcttcc agcagctcgg ggacctggcc attgatatta tggttctagc ttgtcatctt      1260
     agctcttagg actcagccca gggaccattt gtgggtggtg aaagctccta ttattaacaa      1320
     gtacttcttt tgtgtgaaca gcctgtgccc cttttgcgag cagcctcacc ctgtgaacca      1380
     cctgtgtctt gtacaggtag cttgggagaa accagattga atgcagtgcg gtattttaac      1440
     ttaagagaat cttacaccac ttctttccaa gttacatcct ttgttacgaa caactcgttt      1500
     acttatagaa cacatcacca gccatgtggc tcctctcagc cttttggcac aatttaaaaa      1560
     ctgttttaaa tgaaatgtta gtgtggcaaa tgaaccattg ccacctgttc tacagttatc      1620
     agttatcttc atacaagaag tcctgttcaa ctggtacaat atgtactgct gtgtacatat      1680
     aaggtatttt ttaaagagaa acatgccttt attttcctat gtcctttttt atgtttagaa      1740
     tagcctgaga aatcatctgc taaactgtgc tgtaggagaa attctttccc aacggagtcc      1800
     atgctgcctt ttgcgcagca catttgaatt aagattcgag atgtgtcagc tcagtggcaa      1860
     tggagtgttg tcctctaact ctggtacttg tcttttgaga tggcacagcc cattcattca      1920
     ttggtggtag cagcaggttc cctcaggatg cagcaaacta tgaatgctca gtcctctggc      1980
     cttgtcgcag gtaaactgag ggctcaggca gcaactctgc atttgttggc ctccctctat      2040
     gacagctctc taaaggagca agtcttgaaa attgctttgg catcctacca cctgttaaga      2100
     tgcccagcat ctatgtcaaa tcaagtcgtc tctcacctgt tagacacctg gacagcttgc      2160
     tttcatttac cacgatctct tctcagttga tttacatgac tgcctggcca tactttaagg      2220
     caaccagtgg ctaaaatact catgaaatta aatatcagtg attgcactga actgtatact      2280
     tcagatgagc taattttact acgttaattt agcatttatt taagtggaga attaattagt      2340
     tttgtattcc ctattttaca aaaattgata aagatatagt tcatggattt tattctgctg      2400
     ttatgggttt atttctatgg gtctgaaagc ataacatgct cttccatggt tttcccctct      2460
     cggacccagc cctggcttgg caggcctctt tccacagtta acagtgttga tctctgctac      2520
     tcaaccagtc cttctaggaa tgaatctccc atcagcttcg acgtgtgcaa tgccagcata      2580
     gccaccacca ccaccatgtc cacttctgtg tgtcaccagg cccttcagag ttgtagatgt      2640
     gtttgaggct gaccaagtga gcccctgagg acagatggct cacatcttcc tcttgtcagt      2700
     gtcaaatcac tggatgctgt gcagtcctac acattaacct cggttttcaa aagtgttctt      2760
     aaaagaattt ttacagccaa atacatagaa actagatgat ttttcaactt acagaaaact      2820
     acccaactat aagataacca gagacattta ttcaaggaag tttcataagt tatgatcaat      2880
     tctccatgtt taatcatctg ggggatttgt ttctaaacta cagtttaagt gattttagct      2940
     tttgatttgt gttcatcata gatataaaac cttatttgta gatggataaa ctgccatatc      3000
     tgaggtagga gaagctgtga gttcagggac agctttggct acatatcgag ttctgggaca      3060
     gctggcctat attgtggagc cctgtctcaa aatcaatacc                            3100
//


spacer
spacer