spacer

EBI Dbfetch

ID   AK051111; SV 1; linear; mRNA; HTC; MUS; 2115 BP.
XX
AC   AK051111;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 9 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:D030073H22 product:adenylosuccinate lyase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2115
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5b7072e6ddb2d13b7eac2487beed1c11.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D030073H22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2115
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="9 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D030073H22"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             31..1485
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylosuccinate lyase (MGD|MGI:103202 GB|NM_009634,
FT                   evidence: BLASTN, 99%, match=1869)"
FT                   /note="putative"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54822"
FT                   /protein_id="BAC34529.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
XX
SQ   Sequence 2115 BP; 534 A; 532 C; 565 G; 484 T; 0 other;
     ggtccgccgc gtcctggtcg cgtgttgaaa atggctgcat ccggcgaccc tggcagtgct        60
     gaaagttacc gttctccgct ggcggcccgc tacgccagcc gcgagatgtg tttcttgttc       120
     agcgacaggt acaagttcca gacgtggcgg cagctgtggc tgtggctggc ggaggccgaa       180
     cagacgctgg gtttgcctat cacagatgaa caaatccagg agatgaagtc gaacctgaac       240
     aacattgact tccagatggc agctgaggaa gagaagcgcc tgcggcacga cgtgatggct       300
     cacgtgcaca cgtttggcca ctgctgtccg aaagctgcgg gcattattca tctgggcgcc       360
     acctcctgct atgtcggaga caatacggac ctgattattc tgagaaatgc atttgaccta       420
     cttttgccaa agcttgctag agtgatctcg aggcttgccg actttgctaa ggatcgtgct       480
     gatctgccca cgttaggttt cacacacttt cagcctgctc agctgaccac ggttgggaaa       540
     cgatgctgcc tttggattca agatctctgc atggatctcc agaacttgaa gcgtgtccgg       600
     gatgagctgc gcttccgagg agtaaagggc accactggca cgcaggccag cttcctgcag       660
     ctcttcgagg gggatcacca gaaggtggag cagctggaca agatggtgac agaaaaggca       720
     gggtttaaaa gagccttcat catcacagga cagacgtaca cacggaaagt ggacatcgaa       780
     gtgctgtctg tgctggccag cttaggagca tcggtgcaca agatttgcac tgacatacgc       840
     ctgctggcaa acctgaagga gatggaggag ccctttgaga aacagcagat tggctccagt       900
     gcgatgccgt acaagcggaa ccccatgcgc tccgaacgtt gctgcagcct ggcccgtcac       960
     ctgatggccc ttaccatgga cccactacag acagcgtctg tgcagtggtt tgaacgtact      1020
     ctggatgaca gtgccaaccg acggatctgt ttggctgaag cgtttctcac tgcagatact      1080
     atattaaaca ccctacagaa catttctgaa ggattggtgg tgtaccccaa agtaattgaa      1140
     cggcgcattc ggcaagagct gcctttcatg gccacagaga acatcatcat ggcaatggtg      1200
     aaagccgggg gcagccgaca ggactgccat gagaaaatta gagtgctttc ccagcaggca      1260
     gctgctgtgg tcaagcagga aggaggtgac aatgacctta tagagcgcat ccgggcagat      1320
     gcctacttca gccccatcca ctcacagctg gagcacttgc tggacccctc ttctttcact      1380
     ggccgagcac cccagcaggt ccacagattc ctggaagagg aagtgcgccc cctgctaaag      1440
     ccctatggga atgagatggc ggtgaaagca gagctgtgtc tgtagagtag gagagctgag      1500
     gagaacccgg ttacagtgat tagagcttgc tgattacagt gttagagtta ctactgtgtt      1560
     tcttgggggg cactcctttg cacactcagg aggcagaggc aggcagatct ctgagttcaa      1620
     gggccagcct ggtctacaaa acaagttcca ggacagccag agctacacag agaaaccctg      1680
     tctcaacaaa caaacaaaca gaggctgggg acatggcact gactgctctt ccaaaggtcc      1740
     tgagttcaaa tcccagcaac cacatggtgg ctcacaacca tctgtaatga gatctgatgc      1800
     cctcttctgg tgcatgaaga cagctacagt gtattcatat acataaaata aatgaatctt      1860
     taaaaacaaa caaaaagaat gtacattaag ttctcttgct tggggttcac aacagatagc      1920
     cgtgctttct tgttttctcc agtcttttgt tgttgagaca gagtctcaat gtgtatcatt      1980
     ggctgacctg gaacacagaa atctgcctca tctccccagt ggcaggatta aaggtgtgct      2040
     ccaccatgcc tggctgtttt atatttttta cagcaacata atcttgcaga ataatgtagc      2100
     tcatacttat tttcc                                                       2115
//


spacer
spacer