Dbfetch

ID   AK050651; SV 1; linear; mRNA; HTC; MUS; 2285 BP.
XX
AC   AK050651;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:C920029L04 product:cofilin 1, non-muscle, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2285
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 49e727da55ffcb455e9b16b62f81dc19.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024678; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024651; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024678; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024446; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025125; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024418; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024545; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_LPJ_G0024631; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025173; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023664; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023980; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000209469; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050596; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050525; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050269; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051022; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050204; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050301; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_LPJ_T0050425; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051134; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049996; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049563; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C920029L04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2285
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C920029L04"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             77..577
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="cofilin 1, non-muscle (MGD|MGI:101757 GB|NM_007687,
FT                   evidence: BLASTN, 100%, match=1115)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544Y7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y7"
FT                   /protein_id="BAC34363.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
FT   regulatory      2270..2275
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2285
FT                   /note="putative"
XX
SQ   Sequence 2285 BP; 524 A; 570 C; 587 G; 604 T; 0 other;
     gagtcggatc ccggcagcag ctgcggcggc tcaggtcttc agttgctctt tctgtctccc        60
     tttcgtttcc ggaaacatgg cctctggtgt ggctgtctct gatggtgtca tcaaggtgtt       120
     caatgacatg aaggttcgca agtcttcaac accagaagaa gtgaagaaac gcaagaaggc       180
     ggtgctcttt tgcctgagtg aggacaagaa gaacatcatc ctggaggagg gcaaggagat       240
     cctggtagga gatgtggggc agactgtgga cgacccctac accacttttg tcaagatgct       300
     gccagacaag gactgccgct atgcactcta tgatgcaacc tatgagacca aggagagcaa       360
     gaaggaggac ctggtgttca tcttctgggc ccccgagaat gcacccctca agagcaaaat       420
     gatctatgcc agctccaagg atgccatcaa gaagaagctg acaggaatca agcatgaatt       480
     acaagctaac tgctacgagg aggtcaagga ccgctgcacc ctggcagaga aactaggtgg       540
     cagcgccgtc atttccctgg agggcaagcc tttgtgagcc acctccagcc ccctgcctgg       600
     agcatcttaa cagccccaga cctgctcttg ggtgttgcag gctgcccctt tcctgccaga       660
     ccggaggggc tggggggatc ccagcagggg gagggctatc ccttcacccc agttgccaaa       720
     catccctccc accccctgga ccgtccttct ccctccatcc ctgacggttc tggccttccc       780
     aaactgcttt tgatcttctg attcctcttg ggttgacgca gaccaagtcc cgtcctaggc       840
     acccagtttg gggggagcct gtattttttt ttttaacgac acccctactc cgtatccctc       900
     cccatcccat gctgccaact tctaaccaca atagtgactc tgtgcttgtc tgtttagttc       960
     tgtgtgtaaa tgaaatgtgg aaatgaccct ccctgcccca gctggctgcc ctcccctttc      1020
     ctttgatctt gaccactcat ggaagcagga ccagtaaggg accttcaatt taaaacaaaa      1080
     caaaacaaaa aaacaataaa aaggctaatt aacaacatgg cttttgggtt tgggattttg      1140
     gggaccctgt ggtgggagat ggatgggtgg tttccctgtg cttcacctct agttcagtcc      1200
     ctagtaagcg gcatctcctt cttgagttgg ggtgcactgt tccaaggcag ggcagttggg      1260
     ctccgagtgt gtcacacctg aaacttctta cctttatagt ggacagtgag gtaccctgag      1320
     cccctttcca catgtgggct aaatacagtt tacttgggtg acactgcttt ctaaggttct      1380
     cttcagctct cccctctctt ccctctgggg cggttggctc accccactgc cacgttcaga      1440
     ggtgctatga gtagctaagt tgagcctttg gcctcctgta ctgtgactgg agtccattca      1500
     gggtgggtca ggtggattct aggacttcag tctggagccc cacctactgt taccccagct      1560
     aaagcctgag cctttgactt agtgtggatt ctggcctgag ggcaggagag ctggtttcct      1620
     taactggccc caagtctgag aaagttgcag gaaggagctg tcctgttttg atagtgggag      1680
     tagagggaat tgattttttt tttttttttt ttttagcaac agggtttctc tagatgaggc      1740
     tgtgcttaga tcagcttgtc tctgccccct aagtgccggg gttaaaggtg ttcattaaag      1800
     aaatacttta atgttattta gatctgtaag gctttttgct ttagctttga tttcttacaa      1860
     agccccatta aggctggccc attctgtttg gtgtaagaga agacagacac gggaagagta      1920
     cttgtttttc tggggtgctg ggcattgaac ccagggcttt atgcatggta ggcaagcact      1980
     ccacctctga gctgtagcaa cagattggga atttgtgttc ttgaaagaac tgagggtgat      2040
     gcaaatccca gaagcatggg cctatcgcca cttaaaggag ccgagggcat gggctggtga      2100
     gatggctcag tgggtaagag cacccgactg ctcttccttc cgaaggtctg aagttcaaat      2160
     cccagcaacc acatggtggc tcacagccat ctgtaatgaa atctgactcc ctcttctgga      2220
     gggtctgagg acagctacag tgtacttaca tgtaataaat aaataaatga ataaataaaa      2280
     ctttt                                                                  2285
//