spacer

EBI Dbfetch

ID   AK050644; SV 1; linear; mRNA; HTC; MUS; 1878 BP.
XX
AC   AK050644;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:C920028B14 product:albumin 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1878
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e57ab57d497628958046782d8b4c6dae.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C920028B14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1878
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C920028B14"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1731
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="albumin 1 (MGD|MGI:87991 GB|AK010025, evidence:
FT                   BLASTN, 100%, match=1877)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:P07724"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07724"
FT                   /protein_id="BAC34360.1"
FT                   /translation="NRYNDLGEQHFKGLVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTC
FT                   VADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEPERNECFLQHKDDNPSL
FT                   PPFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLYYAEQYNEILTQCCAE
FT                   ADKESCLTPKLDGVKEKALVSSVRQRMKCSSMQKFGERAFKAWAVARLSQTFPNADFAE
FT                   ITKLATDLTKVNKECCHGDLLECADDRAELAKYMCENQATISSKLQTCCDKPLLKKAHC
FT                   LSEVEHDTMPADLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLR
FT                   LAKKYEATLEKCCAEANPPACYGTVLAEFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAI
FT                   LVRYTQKAPQVSTPTLVEAARNLGRVGTKCCTLPEDQRLPCVEDYLSAILNRVCLLHEK
FT                   TPVSEHVTKCCSGSLVERRPCFSALTVDETYVPKEFKAETFTFHSDICTLPEKEKQIKK
FT                   QTALAELVKHKPKATAEQLKTVMDDFAQFLDTCCKAADKDTCFSTEGPNLVTRCKDALA
FT                   "
XX
SQ   Sequence 1878 BP; 538 A; 452 C; 438 G; 450 T; 0 other;
     aatcggtata atgatttggg agaacaacat ttcaaaggcc tagtcctgat tgccttttcc        60
     cagtatctcc agaaatgctc atacgatgag catgccaaat tagtgcagga agtaacagac       120
     tttgcaaaga cgtgtgttgc cgatgagtct gccgccaact gtgacaaatc ccttcacact       180
     ctttttggag ataagttgtg tgccattcca aacctccgtg aaaactatgg tgaactggct       240
     gactgctgta caaaacaaga gcccgaaaga aacgaatgtt tcctgcaaca caaagatgac       300
     aaccccagcc tgccaccatt tgaaaggcca gaggctgagg ccatgtgcac ctcctttaag       360
     gaaaacccaa ccacctttat gggacactat ttgcatgaag ttgccagaag acatccttat       420
     ttctatgccc cagaacttct ttactatgct gagcagtaca atgagattct gacccagtgt       480
     tgtgcagagg ctgacaagga aagctgcctg accccgaagc ttgatggtgt gaaggagaaa       540
     gcattggtct catctgtccg tcagagaatg aagtgctcca gtatgcagaa gtttggagag       600
     agagctttta aagcatgggc agtagctcgt ctgagccaga cattccccaa tgctgacttt       660
     gcagaaatca ccaaattggc aacagacctg accaaagtca acaaggagtg ctgccatggt       720
     gacctgctgg aatgcgcaga tgacagggcg gaacttgcca agtacatgtg tgaaaaccag       780
     gcgactatct ccagcaaact gcagacttgc tgcgataaac cactgttgaa gaaagcccac       840
     tgtcttagtg aggtggagca tgacaccatg cctgctgatc tgcctgccat tgctgctgat       900
     tttgttgagg accaggaagt gtgcaagaac tatgctgagg ccaaggatgt cttcctgggc       960
     acgttcttgt atgaatattc aagaagacac cctgattact ctgtatccct gttgctgaga      1020
     cttgctaaga aatatgaagc cactctggaa aagtgctgcg ctgaagccaa tcctcccgca      1080
     tgctacggca cagtgcttgc tgaatttcag cctcttgtag aagagcctaa gaacttggtc      1140
     aaaaccaact gtgatcttta cgagaagctt ggagaatatg gattccaaaa tgccattcta      1200
     gttcgctaca cccagaaagc acctcaggtg tcaaccccaa ctctcgtgga ggctgcaaga      1260
     aacctaggaa gagtgggcac caagtgttgt acacttcctg aagatcagag actgccttgt      1320
     gtggaagact atctgtctgc aatcctgaac cgtgtgtgtc tgctgcatga gaagacccca      1380
     gtgagtgagc atgttaccaa gtgctgtagt ggatccctgg tggaaaggcg gccatgcttc      1440
     tctgctctga cagttgatga aacatatgtc cccaaagagt ttaaagctga gaccttcacc      1500
     ttccactctg atatctgcac acttccagag aaggagaagc agattaagaa acaaacggct      1560
     cttgctgagc tggtgaagca caagcccaag gctacagcgg agcaactgaa gactgtcatg      1620
     gatgactttg cacagttcct ggatacatgt tgcaaggctg ctgacaagga cacctgcttc      1680
     tcgactgagg gtccaaacct tgtcactaga tgcaaagacg ccttagccta aacacatcac      1740
     aaccacaacc ttctcaggct accctgagaa aaaaagacat gaagactcag gactcatctt      1800
     ttctgttggt gtaaaatcaa caccctaagg aacacaaatt tctttaaaca tttgacttct      1860
     tgtctctgtg ctgcaatt                                                    1878
//


spacer
spacer