spacer

EBI Dbfetch

ID   AK050632; SV 1; linear; mRNA; HTC; MUS; 905 BP.
XX
AC   AK050632;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:C920025O04 product:vesicle-associated membrane
DE   protein, associated protein B and C, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-905
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 246bb8420b60360d9a362ed6d0585375.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C920025O04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..905
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C920025O04"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             72..803
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="vesicle-associated membrane protein, associated
FT                   protein B and C (MGD|MGI:1928744 GB|NM_019806, evidence:
FT                   BLASTN, 99%, match=732)"
FT                   /db_xref="GOA:Q8BH80"
FT                   /db_xref="InterPro:IPR000535"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016763"
FT                   /db_xref="MGI:MGI:1928744"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BH80"
FT                   /protein_id="BAC34353.1"
FT                   /translation="MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVK
FT                   TTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEA
FT                   VWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIIPTSASKTEAPAAAKSLTSPLDD
FT                   TEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRVRKAMPSNSPVAALAATGKEEGLSA
FT                   RLLALVVLFFIVGVIIGKIAL"
XX
SQ   Sequence 905 BP; 235 A; 228 C; 263 G; 179 T; 0 other;
     gctccgcccc tgcgccccgc cacccaggcc gccgcccccc gcccgcgccg tcgcccccga        60
     cggggaggac catggcgaag gtggaacagg tcctgagcct cgagccacaa cacgagctca       120
     agttccgagg tcccttcact gatgttgtca ccaccaacct aaagcttggc aacccaacag       180
     accgaaatgt gtgttttaaa gtgaagacca cagcacctcg caggtactgc gtgcggccca       240
     acagtggggt cattgatgcc ggggcctctc tcaatgtgtc tgtgatgtta cagcctttcg       300
     attatgatcc caatgagaaa agtaaacaca agtttatggt tcagtctatg tttgctccgc       360
     ctgacacttc tgatatggag gcagtatgga aggaggcaaa accggaagac cttatggatt       420
     caaaacttag atgtgtgttt gaattgccag cagaaaatgc taaaccacat gatgtagaaa       480
     taaataaaat catacctacg agtgcatcca agacagaagc accggcagcc gcaaagtccc       540
     tgacatcgcc cctcgatgac acagaagtaa agaaggtgat ggaagagtgc aggcggctgc       600
     agggggaggt gcagaggctt cgggaggaga gcaggcagct caaggaagaa gacggacttc       660
     gggtgaggaa ggcgatgccg agcaacagcc ccgtggcggc tctggcggcc actgggaagg       720
     aggagggcct gagcgcccgg ctgctggccc tggtggttct gttctttatc gttggtgtca       780
     ttatagggaa gattgccttg taggggccgc atgcgaagga tggcaggttg gattgatgga       840
     tctaccacac catgggattc aaatttatca taaccatgcg taaaaagaaa ttaatgtatg       900
     acggc                                                                   905
//


spacer
spacer