spacer

EBI Dbfetch

ID   AK050455; SV 1; linear; mRNA; HTC; MUS; 814 BP.
XX
AC   AK050455;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730049H17 product:hypothetical protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-814
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0eb8b4ae8697972646e16d51042b02b8.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730049H17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..814
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730049H17"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..378
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical protein (evidence: NCBI CDS Predictor)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q91XD7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XD7"
FT                   /protein_id="BAC34266.1"
FT                   /translation="YQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
FT   polyA_signal    792..797
FT                   /note="putative"
FT   polyA_site      814
FT                   /note="putative"
XX
SQ   Sequence 814 BP; 169 A; 207 C; 250 G; 188 T; 0 other;
     taccagcagg tgggctccaa gtgcctagat gtggatgagt gtgagactgt ggtgtgtcca        60
     ggagagaatg agaagtgtga aaacacggag ggaggctacc gctgtgtctg tgctgagggc       120
     tacagacagg aggacggcat ctgcgtgaag gagcaggtcc cggagtcggc gggcttcttt       180
     gcggagatga cggaggatga aatggtggtt ctgcagcaga tgttctttgg tgtaatcatc       240
     tgtgcgctgg ccacgcttgc tgccaagggt gacttggtgt tcactgccat cttcattgga       300
     gctgtggcag ccatgactgg gtactggttg tcagagcgga gtgaccgtgt gctggagggc       360
     ttcatcaagg gtagataatc cctgccgcca ctcacaggat ttcctcccac ccaggctgct       420
     cctagaggtt atttctctct ccctatggat acctgggaca gcatagtttc tctttgagac       480
     tggggtaaac acccttttac ctgccttact gagcagccca ggaccccagt ggccccaggg       540
     ggttgaaaaa gaggtcctga agcagatgcc acgagatcct agcctaggac actggcaggc       600
     ctcaccgtgt atgaatccca agacagtttc tccccaggga ggttgcaggt gggctttggc       660
     ccctgacccg gatgagaggt gtcccctcag gggtgggccc ccataggccc cttgccaggt       720
     gcatgctgcc agctccagct gtgtattcac cgcccacgcc ctagccatcg acttatttat       780
     tcatctcagg aaataaagga cggtcttgaa aatg                                   814
//


spacer
spacer