spacer

EBI Dbfetch

ID   AK050297; SV 1; linear; mRNA; HTC; MUS; 1067 BP.
XX
AC   AK050297;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730035I17 product:osteomodulin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1067
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 525277d03f95b0bf7ec624d0bf17cf8d.
DR   Ensembl-Gn; ENSMUSG00000048368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065494; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730035I17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1067
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730035I17"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             3..632
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="osteomodulin (MGD|MGI:1350918 GB|NM_012050,
FT                   evidence: BLASTN, 99%, match=853)"
FT                   /note="putative"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="MGI:MGI:1350918"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C7G2"
FT                   /protein_id="BAC34172.1"
FT                   /translation="MQLNLCNNRLESMPLGLPSSLMYLSLENNSISSIPDNYFDKLPKL
FT                   HALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPRNLEHLYLQNNEIESINVT
FT                   MICPSPDPVHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSIYYGEQRSTNGETIQLKT
FT                   QVFRSYQEEEEEDDHDSQDNTLEGQEVSDEHYNSHYYEMQEWQDTI"
XX
SQ   Sequence 1067 BP; 389 A; 204 C; 174 G; 300 T; 0 other;
     aaatgcagct caacctatgt aataacagat tagaatcaat gccccttgga ttgccttcat        60
     cacttatgta tctatcttta gaaaataatt caatttcatc tataccagac aattattttg       120
     acaaacttcc aaaacttcat gctctaagaa tatcacacaa caaactggaa gacattccat       180
     atgacatctt taatctttcc aatcttatag aactcaacgt tggacacaat aaattgaagc       240
     aagcattcta cattccaagg aatttggaac atctatacct acaaaataat gaaatagaaa       300
     gcatcaatgt gacaatgata tgtccttctc ctgatccagt acaccatcac catttaacat       360
     accttcgtgt ggaccaaaat aagctgaaag aaccaataag ttcatacatc ttcttctgct       420
     tccctcgtat acacagtatt tattatggtg agcagaggag tactaacggt gaaacaattc       480
     aactgaagac ccaagttttc aggagctacc aagaggagga agaggaagac gaccatgaca       540
     gtcaggacaa cactcttgag ggtcaagaag tatcagatga gcactataat tctcattact       600
     atgagatgca agagtggcaa gatactatat aggtacacat ttatgcctcc ataaagcctt       660
     actaattaca aatgtaaaca tgtaactgct cataataata tatctacaag tatgtgttag       720
     tataaagatc agaactgcat ttaagatgtt ggtgaaaatg gctttacttc ataagcttag       780
     agcttactaa aaatgatgca aatcttaaga aatataaaat agaatggtaa gtgggaataa       840
     aaaaaactaa gctcaaatgg ctttgtatat tctttaaact tagaaatatt atcatgcaaa       900
     aacttgtaag ggccagcaag atggttcagc agataaagca tttactaccg agcctgacga       960
     ctttgagtag agagactcaa ttcccgcagg ttgtcaactt ttcctctgcc acgtgtgcta      1020
     gtgtgcatgt tcctgacaat gacgatgata aattacataa aatcctc                    1067
//


spacer
spacer