spacer

EBI Dbfetch

ID   AK050295; SV 1; linear; mRNA; HTC; MUS; 1999 BP.
XX
AC   AK050295;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730035E04 product:serine (or cysteine) proteinase
DE   inhibitor, clade C (antithrombin), member 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1999
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bfe892ea8bdfce3f0d11cc0577d65d0a.
DR   Ensembl-Gn; ENSMUSG00000026715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064725; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730035E04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1999
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730035E04"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             55..1452
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="serine (or cysteine) proteinase inhibitor, clade C
FT                   (antithrombin), member 1 (MGD|MGI:88095 GB|NM_080844,
FT                   evidence: BLASTN, 99%, match=1398)"
FT                   /db_xref="GOA:Q543J5"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR015555"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:88095"
FT                   /db_xref="UniProtKB/TrEMBL:Q543J5"
FT                   /protein_id="BAC34171.1"
FT                   /translation="MYSPGAGSGAAGERKLCLLSLLLIGALGCAICHGNPVDDICIAKP
FT                   RDIPVNPLCIYRSPGKKATEEDGSEQKVPEATNRRVWELSKANSRFATNFYQHLADSKN
FT                   DNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRL
FT                   YRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNW
FT                   VANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCP
FT                   VPMMYQEGKFKYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEW
FT                   LDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSD
FT                   AFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGR
FT                   VANPCVN"
FT   polyA_signal    1977..1982
FT                   /note="putative"
FT   polyA_site      1999
FT                   /note="putative"
XX
SQ   Sequence 1999 BP; 548 A; 503 C; 486 G; 462 T; 0 other;
     cgagttttcg gagtgatcgt ctcagtcagc accatctctg taggagcatc ggccatgtat        60
     tcccctgggg caggaagtgg ggctgctggt gagaggaagc tttgtctcct ctctctgctc       120
     ctcatcggtg ccttgggctg tgctatctgt cacggaaacc ctgtggacga catctgcata       180
     gcgaagcccc gagacatccc cgtgaatccc ttgtgcattt accgctcccc tgggaagaag       240
     gccaccgagg aggatggctc agagcagaag gttccagaag ccaccaaccg gcgggtctgg       300
     gaactgtcca aggccaattc gcgatttgcc actaacttct accagcacct ggcagactcc       360
     aagaatgaca acgacaacat tttcctgtca cccttgagca tctccactgc ttttgctatg       420
     accaagctgg gtgcctgtaa cgacactctc aagcagctga tggaggtttt taaatttgat       480
     accatctccg agaagacatc cgaccagatc cacttcttct ttgccaaact gaactgccga       540
     ctctatcgaa aagccaacaa gtcctctgac ttggtatcag ccaaccgcct ttttggagac       600
     aaatccctca ccttcaacga gagctatcaa gatgttagtg aggttgtcta tggagccaag       660
     ctccagcccc tggacttcaa ggagaatccg gagcaatcca gagtgaccat caacaactgg       720
     gtagctaata agactgaagg ccgcatcaaa gatgtcatcc cacagggcgc cattaacgag       780
     ctcactgccc tggttctggt taacaccatt tacttcaagg gcctgtggaa gtcaaagttc       840
     agccctgaga acacaaggaa ggaaccgttc tataaggtcg atgggcagtc atgcccagtg       900
     cctatgatgt accaggaagg caaattcaaa taccggcgcg tggcagaggg cacccaggtg       960
     ctagagctgc ccttcaaggg ggatgacatc accatggtgc tcatcctgcc caagcctgag      1020
     aagagcctgg ccaaggtgga gcaggagctc accccagagc tgctgcagga gtggctggat      1080
     gagctgtcag agactatgct tgtggtccac atgccccgct tccgcaccga ggatggcttc      1140
     agtctgaagg agcagctgca agacatgggc ctcattgatc tcttcagccc tgaaaagtcc      1200
     caactcccag ggatcgttgc tggaggcagg gacgacctct atgtctccga cgcattccac      1260
     aaagcatttc ttgaggtaaa tgaggaaggc agtgaagcag cagcgagtac ttctgtcgtg      1320
     attactggcc ggtcactgaa ccccaatagg gtgaccttca aggccaacag gcccttcctg      1380
     gttcttataa gggaagttgc actgaacact attatattca tggggagagt ggctaatcct      1440
     tgtgtgaact aaaatattct taatctttgc accttttcct actttggtgt ttgtgaatag      1500
     aagtaaaaat aaatacgact gccacctcac gagaatggac ttttccactt gaagacgaga      1560
     gactggagta cagatgctac accacttttg ggcaagtgaa gggggagcag ccagccacgg      1620
     tggcacaaac ctatatcctg gtgcttttga aggtagaagc agggcggtca ggagttaagg      1680
     ccagttgagg ctgggctgca gagtgaaaga ccatgtctca agatggtctt tctcctcccc      1740
     aaagtagaaa agaaaaccat aaaaacaaga ggtaaatata ttactatttc atcttagagg      1800
     atagcaggca tcttgaaagg gtagagggac cttaaattct cattattgcc cccatactac      1860
     aaactaaaaa acaaacccga atcaatctcc cataaagaca gagattcaaa taagagtatt      1920
     aaacgtttta tttctcaaac cactcacatg cataatgttc ttatacacag tgtcaaaata      1980
     aagagaaatg catttttat                                                   1999
//


spacer
spacer