spacer

EBI Dbfetch

ID   AK050248; SV 1; linear; mRNA; HTC; MUS; 2030 BP.
XX
AC   AK050248;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730030P03 product:albumin 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2030
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a1bf98010891b88d863fbab9fa2bcdf6.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
DR   EuropePMC; PMC2714216; 19414862.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730030P03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2030
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730030P03"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             36..1862
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="albumin 1 (MGD|MGI:87991 GB|AK010025, evidence:
FT                   BLASTN, 99%, match=2021)"
FT                   /note="putative"
FT                   /db_xref="GOA:P07724"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07724"
FT                   /protein_id="BAC34145.1"
FT                   /translation="MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKG
FT                   LVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNL
FT                   RENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYL
FT                   HEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRM
FT                   KCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDR
FT                   AELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVC
FT                   KNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTVLA
FT                   EFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVG
FT                   TKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTV
FT                   DETYVPKEFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDDFA
FT                   QFLDTCCKAADKDTCFSTEGPNLVTRCKDTLA"
FT   polyA_signal    2010..2015
FT                   /note="putative"
FT   polyA_site      2030
FT                   /note="putative"
XX
SQ   Sequence 2030 BP; 576 A; 497 C; 468 G; 489 T; 0 other;
     gacctttcct atcaacccca ctagcctctg gcaaaatgaa gtgggtaacc tttctcctcc        60
     tcctcttcgt ctccggctct gctttttcca ggggtgtgtt tcgccgagaa gcacacaaga       120
     gtgagatcgc ccatcggtat aatgatttgg gagaacaaca tttcaaaggc ctagtcctga       180
     ttgccttttc ccagtatctc cagaaatgct catacgatga gcatgccaaa ttagtgcagg       240
     aagtaacaga ctttgcaaag acgtgtgttg ccgatgagtc tgccgccaac tgtgacaaat       300
     cccttcacac tctttttgga gataagttgt gtgccattcc aaacctccgt gaaaactatg       360
     gtgaactggc tgactgctgt acaaaacaag agcccgaaag aaacgaatgt ttcctgcaac       420
     acaaagatga caaccccagc ctgccaccat ttgaaaggcc agaggctgag gccatgtgca       480
     cctcctttaa ggaaaaccca accaccttta tgggacacta tttgcatgaa gttgccagaa       540
     gacatcctta tttctatgcc ccagaacttc tttactatgc tgagcagtac aatgagattc       600
     tgacccagtg ttgtgcagag gctgacaagg aaagctgcct gaccccgaag cttgatggtg       660
     tgaaggagaa agcattggtc tcatctgtcc gtcagagaat gaagtgctcc agtatgcaga       720
     agtttggaga gagagctttt aaagcatggg cagtagctcg tctgagccag acattcccca       780
     atgctgactt tgcagaaatc accaaattgg caacagacct gaccaaagtc aacaaggagt       840
     gctgccatgg tgacctgctg gaatgcgcag atgacagggc ggaacttgcc aagtacatgt       900
     gtgaaaacca ggcgactatc tccagcaaac tgcagacttg ctgcgataaa ccactgttga       960
     agaaagccca ctgtcttagt gaggtggagc atgacaccat gcctgctgat ctgcctgcca      1020
     ttgctgctga ttttgttgag gaccaggaag tgtgcaagaa ctatgctgag gccaaggatg      1080
     tcttcctggg cacgttcttg tatgaatatt caagaagaca ccctgattac tctgtatccc      1140
     tgttgctgag acttgctaag aaatatgaag ccactctgga aaagtgctgc gctgaagcca      1200
     atcctcccgc atgctacggc acagtgcttg ctgaatttca gcctcttgta gaagagccta      1260
     agaacttggt caaaaccaac tgtgatcttt acgagaagct tggagaatat ggattccaaa      1320
     atgccattct agttcgctac acccagaaag cacctcaggt gtcaacccca actctcgtgg      1380
     aggctgcaag aaacctagga agagtgggca ccaagtgttg tacacttcct gaagatcaga      1440
     gactgccttg tgtggaagac tatctgtctg caatcctgaa ccgtgtgtgt ctgctgcatg      1500
     agaagacccc agtgagtgag catgttacca agtgctgtag tggatccctg gtggaaaggc      1560
     ggccatgctt ctctgctctg acagttgatg aaacatatgt ccccaaagag tttaaagctg      1620
     agaccttcac cttccactct gatatctgca cacttccaga gaaggagaag cagattaaga      1680
     aacaaacggc tcttgctgag ctggtgaagc acaagcccaa ggctacagcg gagcaactga      1740
     agactgtcat ggatgacttt gcacagttcc tggatacatg ttgcaaggct gctgacaagg      1800
     acacctgctt ctcgactgag ggtccaaacc ttgtcactag atgcaaagac accttagcct      1860
     aaacacatca caaccacaac cttctcaggc taccctgaga aaaaaagaca tgaagactca      1920
     ggactcatct tttctgttgg tgtaaaatca acaccctaag gaacacaaat ttctttaaac      1980
     atttgacttc ttgtctctgt gctgcaatta ataaaaaatg gaaagaatcc                 2030
//


spacer
spacer