Dbfetch

ID   AK049884; SV 1; linear; mRNA; HTC; MUS; 4356 BP.
XX
AC   AK049884;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630007E24 product:5-HYDROXYTRYPTAMINE 1A RECEPTOR (5-HT-1A)
DE   (SEROTONIN RECEPTOR) (5- HT1A), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4356
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6966df26071ff488fd4b87a68ddb22d9.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020866; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020841; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020866; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021300; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020174; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020723; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020751; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021339; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019927; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020232; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038095; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038040; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038005; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038052; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037802; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038510; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037713; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037857; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037822; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037976; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037813; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037414; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037206; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630007E24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4356
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630007E24"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             493..1758
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-HYDROXYTRYPTAMINE 1A RECEPTOR (5-HT-1A) (SEROTONIN
FT                   RECEPTOR) (5- HT1A) (SWISSPROT|Q64264, evidence: FASTY,
FT                   99.5%ID, 100%length, match=1263)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="BAC33970.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
FT   regulatory      4340..4345
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4356
FT                   /note="putative"
XX
SQ   Sequence 4356 BP; 1060 A; 1071 C; 1062 G; 1163 T; 0 other;
     gagcagactg gagaaggcag gagagatgga gagacagaga gaaggaacta ggagatgagg        60
     gtcatcgagt gacccgggag gatggggttt ctggaatcca gagacttctg agactattag       120
     ttactcggga gagtccggcc cccacgcagc cagttggaca gcgacaaagt gaaatggaca       180
     gcgcgagaca gatattacag ccatctctcc agcacccaga gatttggaag atgctttcag       240
     cccaactaca gtttcctagc tggagcctct gagcgctcag gacccgcggg agccaagcaa       300
     gagagcgccg gtgagtgctc ctctcagatg ccttcgccag agcaagtaag aacttcccgc       360
     tccagtctct agatcccctc ccttcgaaac tccccagaaa ggaaggaaga ccctaggggg       420
     aggggcgagg gagatcccct tgcatttctt tttccctccc ttccccccac cccagcggga       480
     gtgcaggcag gcatggatat gttcagtctt ggccagggca acaacaccac aacgtccctg       540
     gagcccttcg ggacaggcgg caacgatact ggcctctcca acgtgacctt cagctaccaa       600
     gtgatcacct ctcttttgct ggggacgctc attttctgcg cggtgctcgg caatgcctgc       660
     gtggttgctg ccatcgccct ggagcgctcc cttcagaatg ttgccaacta tctcatcggc       720
     tccttggcgg tcaccgatct catggtgtca gtgctggtgc tgcccatggc tgctctgtac       780
     caggtgctca acaagtggac tctgggtcag gtcacctgtg acctgtttat cgccctggat       840
     gtgctgtgct gcacttcgtc catcctgcac ctgtgcgcca tcgcgctaga caggtactgg       900
     gcaatcaccg accctataga ctacgtgaac aagaggacgc cccggcgcgc cgctgcgctg       960
     atctcgctca cttggctcat tggctttctc atctccatcc cgcctatgct gggctggcgc      1020
     accccggaag accgctcgaa ccccaacgag tgcaccatca gcaaggacca cgggtacacc      1080
     atctactcca ctttcggcgc tttctatatt ccgctgctgc tcatgctggt cctctatggg      1140
     cgcatcttca gagccgcgcg cttccgaatc cgcaagacgg tcaagaaggt ggaaaagaag      1200
     ggagcgggca ccagcttcgg aacatcgtcg gccccgcccc ccaagaagag cctgaatggt      1260
     cagccaggta gtggggactg caggcgcagt gctgagaaca gggcggtggg gactccgtgc      1320
     gctaatgggg cggtgagaca gggtgaggac gacgccaccc tggaggtgat cgaggtgcat      1380
     cgagtgggca actccaaagg gcaccttcct ctgcccagcg aatcaggagc tacctcctat      1440
     gtccccgcct gcttggagag aaaaaatgag cgcactgctg aggcaaagcg caagatggcc      1500
     ttggcccgtg agaggaagac agtgaagaca ctgggcatca tcatgggcac cttcatcctc      1560
     tgctggctgc cctttttcat tgtggccctg gtcctacctt tctgtgagag cagttgccac      1620
     atgcctgagt tgttgggtgc cataattaac tggctaggct actccaactc cctgctcaac      1680
     ccagttattt atgcttattt caacaaagac tttcaaaacg cttttaagaa gatcatcaag      1740
     tgcaagttct gccgctgatg atgatgatgg tggtggtagt ggtggtaata gtggtggtga      1800
     tggagaagga agaagtggag gaagagtgta gggcttacag gacccttcct gttcactcaa      1860
     tatccccgcc ctggaagcaa cacctaagaa aacttgcttt tcctagaaca cgcagcttct      1920
     tagcccatgg ctttcagatc ttctctctct atctcatttt aaggggacag tgctttttgc      1980
     agaaatctta gagaacccct agcatctgtt tgtaaaatta ttggctcggt ctttggccct      2040
     aggatcagtt ttgatagttg caataacctc ctctctattc gaaatcccaa ttcttcacga      2100
     tggaagttta aacctcggcg attcaaggaa gaaaacccaa acagaaaata taaactgtat      2160
     ggacatctac catgcccact aggactgcca ccctctgccc tatatctgga actttgaggt      2220
     tcaagactgc tctgtctctc cctccctctt gctctagaaa catctgttcc ctttgggtgt      2280
     caatgtacac tgctgattct ggtctccatg cactcacggc tggtctggga aagttggaac      2340
     tactttgggt tatggtgccc tggaattgtt tgccttgctg aatagcaaaa gatccctttc      2400
     cccaatgcac agcacccact ttctgtattt tgtttgtttg tttgttttaa ctcaaaatca      2460
     agtgacaaag atgtctgctg gagtggactt ataagcaaga agccaggccc aaaaggaaga      2520
     gccaagaagg cctgcggatg ttttcctgtc ctggtgtcag cactcaccaa agaaattgac      2580
     aatcagacta tttggaagga agagttttat tcctgtagtt tgttggcttt tctgtaagtt      2640
     ctggaaaggc cttgtggact gcagaaggcg cccactgctg gccagggagg gctcattgag      2700
     ggtgctgaga tgcccgggat ggctcacctc accctcagtt tcttttctag gagtgagcta      2760
     tgccagagca gctcaccttg agtttgcagc ctccgggttc ctccactcac ctctcacagt      2820
     atccaggagc tagtagagaa gtttgagttt gtgcaagagg ttggagactt agaatttcta      2880
     aggaagtgtg ggtgtgaggc acgtagagga ggtaaggagc aaaagggctc ctaagtgctt      2940
     ccaactcctg cggcgtgccc agggggtggg ggtgacctaa aggggcaatt ttaagcatag      3000
     gatgcaaagt ttctcaatct accccttccc cctttcaagg aacagcattg tgtagcattt      3060
     cctaaaaatg cccggattta ttctccggga cattctgtgc tcacacaaat ttcgcagatc      3120
     tctgggctct cattgtgaag ggtatcaaca cctcaccatt acctacctag gatcttgatc      3180
     tcagagacct aaaagagaga gcgatctctg tggagtccca gccaagtcag cccccaaatt      3240
     ctgagggtaa aaccagtttt gtgtcctctc aatttttaaa gcatttttct ccgctagggg      3300
     ttcttttcct gctgttattt ttgctgtccc acccccacct cagagaagaa aattatttag      3360
     gtgcttcctt tgaatgtaca tttctagcta agtgagaggg catcaaatgg ttttgcgtta      3420
     tatctgaact tcgaattttc tgttgaataa tggtttcctt ttcaagcaat tatacggaga      3480
     tttttttcac cccccatccc cttcagctgt atctttccaa tgtctgcacc tgctgttttg      3540
     aaaacccgtg ctgcattttt tttttaaatt gccaaagttg ctggtgagat ctcccccttg      3600
     tgtttataaa cagggagaaa ggactgccct gccacatgaa gccattgttt ttatttgtta      3660
     aactgagcaa agtttctttt gctctactct aaagtgggaa tgagtattac agtcccttgc      3720
     aacagagcca tttcagaatg taagcctgta gggtgtccac acctgagaga ctgacagggg      3780
     gttctgtgga gaagacgcac tgggctgggc ttctccagta caaacagtac ttgtttgtaa      3840
     atttagcttg ctttatttgt ttgtttgttt atttatttat cacaaaaatg aagtagaact      3900
     atatggccaa ataatatttt tctgtatgct ttactatttt tagaccagat catttacttg      3960
     aaataaagat catttacttg aaataaatca atccctaaat ttcagatgtt aaattggaaa      4020
     ccaagacctc taacttccag ttctctgtat tttttttttt ccaattagga atgtttgacc      4080
     gtgatggggg aggggcattg ctcttgttac tttgagaaag agactttaaa caagactgga      4140
     aagggggcac ccagctggaa tataattgcc aagtaataga gcaatcagag aactaagtgc      4200
     aacatgccgc acagctctaa agaacccctg atgcttgttt tattttaaaa tacttgtatt      4260
     acagtaaaat gttaatgcat caaaattggc cttcactttt ccttgtgata ataaaggact      4320
     ttagtaatgg caatgctgta ataaactaag accagt                                4356
//