spacer

EBI Dbfetch

ID   AK049856; SV 1; linear; mRNA; HTC; MUS; 4321 BP.
XX
AC   AK049856;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630004B07 product:solute carrier family 11 (proton-coupled
DE   divalent metal ion transporters), member 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4321
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bd5b79429ce387b846ac28b09e46f206.
DR   Ensembl-Gn; ENSMUSG00000023030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138843; mus_musculus.
DR   EuropePMC; PMC2913348; 20558581.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630004B07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4321
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630004B07"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             81..1766
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 2 (MGD|MGI:1345279
FT                   GB|NM_008732, evidence: BLASTN, 99%, match=1689)"
FT                   /db_xref="GOA:P49282"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="MGI:MGI:1345279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49282"
FT                   /protein_id="BAC33960.1"
FT                   /translation="MVLDPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEE
FT                   PFTTYFDEKIPIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKL
FT                   LWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELAIIGSDMQ
FT                   EVIGSAIAINLLSAGRVPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTF
FT                   GYEYITVKPSQSQVLRGMFVPSCPGCRTPQVEQAVGIVGAVIMPHNMYLHSALVKSRQV
FT                   NRANKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFEKTNKQVVEVCKNNSSP
FT                   HADLFPSDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVME
FT                   GFLNLKWSRFARVILTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPIL
FT                   TFTSLRPVMSEFSNGIGWRIAGGILVLIVCSINMYFVVVYVQELGHVALYVVAAVVSVA
FT                   YLTFVFYLGWQCLIALGLSFLDCGRSVSISKVLLSEDTSGGNIK"
FT   polyA_signal    4300..4305
FT                   /note="putative"
FT   polyA_site      4321
FT                   /note="putative"
XX
SQ   Sequence 4321 BP; 928 A; 1075 C; 1112 G; 1206 T; 0 other;
     gatggagtcg ccggcgcggc gtgtgtggag gtggcggagc cgaatcctat tctaagagca        60
     cagaccctca ggtatctacc atggtgttgg atcctaaaga aaagatgcca gacgatggcg       120
     cttctgggga ccatggagac tctgccagcc ttggcgccat caaccctgcc tacagcaact       180
     catccctccc acattccact ggagactctg aggagccctt caccacctac tttgatgaga       240
     aaatccccat tcctgaggag gagtactctt gttttagctt tcgtaaactc tgggcgttca       300
     cggggcctgg ctttcttatg agcattgcct acctagaccc aggaaacatc gaatctgatt       360
     tgcagtctgg agcagtggct ggatttaagc tgctctgggt gctcctcttg gccaccattg       420
     tggggctgct gctccagcgc cttgcagcga gacttggagt ggtcaccggc ttgcatcttg       480
     ctgaagtatg tcaccgtcag tatcccaagg tcccacggat catcctgtgg ctgatggtgg       540
     agttggcaat cattggttct gacatgcagg aagtcattgg ctcagccatc gccatcaatc       600
     tcctgtctgc aggaagggtc cccctgtggg gcggagtcct catcaccatc gcagacactt       660
     ttgtgtttct ttttttggac aaatatggct tgcggaagct ggaagcgttt tttggctttc       720
     tcatcactat catggccctc acgtttggat atgagtacat tacagtgaag cccagccaga       780
     gccaagtact caggggcatg ttcgtgccgt cctgtccagg gtgccgcacc cctcaggtgg       840
     agcaggcggt gggcatcgtg ggagctgtga tcatgccgca caacatgtac ctgcattctg       900
     ccttagtcaa gtctagacag gtgaatcggg ccaataagca ggaagtgcgg gaagccaata       960
     agtacttctt catcgagtcc tgcatcgcgc tctttgtttc cttcatcatc aatgtctttg      1020
     tcgtgtccgt ctttgctgaa gcattttttg agaaaaccaa caagcaggtg gttgaagtct      1080
     gcaaaaataa cagcagcccc catgctgacc tctttcccag tgacaactct actctggctg      1140
     tggacatcta caaagggggt gttgtgcttg gatgttactt cgggcctgca gctctctaca      1200
     tctgggcagt ggggatcctg gctgccggtc agagctccac catgactgga acctattctg      1260
     gccagtttgt catggaggga ttcctgaacc taaaatggtc gcgctttgcc cgagtgatcc      1320
     tgacccggtc tatcgccatc atccccaccc tgctcgtcgc tgtcttccag gatgtggagc      1380
     acctaacggg gatgaatgac ttcctgaatg tcctgcagag cttacagctc ccctttgctc      1440
     tcatacccat cctcacgttc acaagcctgc ggccagtgat gagtgagttt tccaatggaa      1500
     taggctggag gattgccggt ggcatcctgg tcctgatcgt ctgctccatc aacatgtact      1560
     ttgtagtggt ttatgtccag gagctagggc atgtggcact ctatgtggtg gctgcagtgg      1620
     ttagcgtggc ttatttgacc tttgtgttct acttgggttg gcagtgtttg attgcattgg      1680
     gtctgtcttt cctggactgt ggacgctcgg taagcatctc gaaagtcctg ctgagcgaag      1740
     ataccagcgg tggcaacatt aagtaaacac tggatcagtc tgtctgtctt tgcagggagc      1800
     catcagagcc agtgtgtttc tatggtttac tgtgtgaaca tagccacaag tatgtgctgt      1860
     tgcacagact gcatttagga ctcaactgtt agttgggaaa cactgatgtg tgtgtgtgtg      1920
     tgtgtgtata tgtgtgtgtg tgtgtgtgtt aaggtctttg tttccttttg tttttgtgaa      1980
     atagcatctt gctattaaat actaggttgc ctaaaactca ctatgtagct taggctgtgc      2040
     tcaaacctac agcaatcctt ctgacctaag ctcctgagtg ctgggattcc aggcacgtct      2100
     accatgcctg gctctcatgt atgcttaaga tgagttttgt tgggggtcag ggtggggggt      2160
     agggggtctt accctgtagc attaggcagc accttgaaaa ggtggccctt gagctgtttt      2220
     aaacactaag tttctaaata gctgcccaag ggcagtagct tgtttttagt caaaagaaac      2280
     gcaaccagac tgtcgccatc cttgaattat agaatgagac tgctgccttt gaagtcaggg      2340
     tttttgtttg gtgcattttg tttgtttttc aagagttttt tcgtggctgt cctggaactt      2400
     actctgtaga ccaggatggc ttcgaactca cagagatcct cctgcctctg cctctgcctc      2460
     tacctcccga gtgctaggat tagaggcaga cacctccact gccctgctgg ttcaggattt      2520
     tttttttttt atttctactt cggaatttct cagtggaaag aaaaaaaagg tagggcataa      2580
     gtggtgggtg tggacagatg atggctcacc tgcagtgcag gttttcctta aggaatggag      2640
     cttagcaggg agggcttcat ctttagccct gaggttagta acttccctgc taatatcaag      2700
     ccttcctgat atgttgaatc ttgagcacac acagtccctg aatctttctc ttctgagaga      2760
     gtgctgcctg cagaagactg tagcactcgt ggactgactt ttatgaggct ctggactcgg      2820
     aacgagtcac agagctaact gcactactcc caaaagtacc cttcaccaaa tcatgtctct      2880
     ggcgctgcca ttccacgccc aagataactc agaaggcaat ctcaggagct ctggacccaa      2940
     accttgcaaa gtcagtaggt gtcactggtg tgaagtcctc tcccggcaag gtgggcctgg      3000
     gctgtatcct aacagccctt cctcggagag aaagcctgct gaggccagac tgcgaagctc      3060
     tggagtcttc agcaccgaac tgctgccctc agttcagcta cttctgacct gtcacggggg      3120
     agacgtgatt ctgtcacatc aaatgctgtc tgtctgctgg agaggagtga cacaagagtg      3180
     tgtgatcatt gtcttggtgg cagcgggagc tagagctgct tcgaaggatg tcctctctga      3240
     cgctttccct gtggcgagcg ggccgacaaa tggcctttgc tgtctgtgcc tctgtagcgc      3300
     tcctgctagc atttctcaca gtcagaggct cagcctgcat agatctttat gaggcataca      3360
     ttatcaatcg ctgtgtttca ctcacccaca gctaatccaa caaaaccagg tcacgggtcc      3420
     ctcccagcag cattcccaac ctgtggttgc cacccatctg caaccctata ttcgaagaca      3480
     tttacctcat gatttgtaac agtagcaaga ttagttacaa agtagcaaaa ttattattgg      3540
     gtgtgacccc cagcatgagg agctgactta aaagagtggc agcttccgga aggtggggaa      3600
     cccctgcact acagggtcct cctcccccct gcccccctcc cccactgttc ccgaaggcta      3660
     gaagctgagc ttttgaacct gtgcagtgct tgagggccag gctgacggca gcagaattcc      3720
     ttgcatagat gctctagtga tgtctgcatt tgtacaggga tggggtgggg cgagcagagt      3780
     gtatccagat tcgccatact taaagagtcc agcctgaagc tgcttgggat cgcgcccagg      3840
     gctctgcctc gtgtgttcta ggcaaggctc cgttgcacat ctcacttcct gccccagaat      3900
     tctgttgtgt tatacttgtt tacaatgata gaaggtttcg ttgtgtgata cggtctcttc      3960
     tgactctctg actacaatat ttacagtgtc aaaagattaa aaatgttccc tattcacttg      4020
     attgtcactg aaaacggtac ttcaacagta cagtaacctg taaacatttc acgcccccca      4080
     cgcaactctg ctaccggcat tatatttgtg agccatcttt gtgcattctc tgaattggtc      4140
     cttgttctta tgtgacctga aatagttgtc ccctcagtgc actgggagct gacaggccgg      4200
     ggagtagcgg cagcttgtct tgtgagatcc tgccaggtcg gcagcaagtg gcttcaagga      4260
     ggctttagtg aactttttac agcttgtgaa cgtgctgtga ttaaaccaga gcttcccgct      4320
     t                                                                      4321
//


spacer
spacer