Dbfetch

ID   AK049814; SV 1; linear; mRNA; HTC; MUS; 3888 BP.
XX
AC   AK049814;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630001G15 product:5-HYDROXYTRYPTAMINE 1A RECEPTOR (5-HT-1A)
DE   (SEROTONIN RECEPTOR) (5- HT1A), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3888
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b56375d6dab7c364220819cd5ebe1480.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020866; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020841; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020866; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021300; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020174; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020617; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020723; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020751; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021339; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019927; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020232; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038095; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038040; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038005; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038052; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037802; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038510; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037713; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037857; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037822; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037976; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037813; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0037414; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037206; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630001G15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3888
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630001G15"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             402..1667
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="5-HYDROXYTRYPTAMINE 1A RECEPTOR (5-HT-1A) (SEROTONIN
FT                   RECEPTOR) (5- HT1A) (SWISSPROT|Q64264, evidence: FASTY,
FT                   99.5%ID, 100%length, match=1263)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="BAC33931.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRTPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
FT   regulatory      3870..3875
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3888
FT                   /note="putative"
XX
SQ   Sequence 3888 BP; 906 A; 995 C; 951 G; 1036 T; 0 other;
     tggaatccag agacttctga gactattagt tactcgggag agtccggccc ccacgcagcc        60
     agttggacag cgacaaagtg aaatggacag cgcgagacag atattacagc catctctcca       120
     gcacccagag atttggaaga tgctttcagc ccaactacag tttcctagct ggagcctctg       180
     agcgctcagg acccgcggga gccaagcaag agagcgccgg tgagtgctcc tctcagatgc       240
     cttcgccaga gcaagtaaga acttcccgct ccagtctcta gatcccctcc cttcgaaact       300
     ccccagaaag gaaggaagac cctaggggga ggggcgaggg agatcccctt gcatttcttt       360
     ttccctccct tccccccacc ccagcgggag tgcaggcagg catggatatg ttcagtcttg       420
     gccagggcaa caacaccaca acgtccctgg agcccttcgg gacaggcggc aacgatactg       480
     gcctctccaa cgtgaccttc agctaccaag tgatcacctc tcttttgctg gggacgctca       540
     ttttctgcgc ggtgctcggc aatgcctgcg tggttgctgc catcgccctg gagcgctccc       600
     ttcagaatgt tgccaactat ctcatcggct ccttggcggt caccgatctc atggtgtcag       660
     tgctggtgct gcccatggct gctctgtacc aggtgctcaa caagtggact ctgggtcagg       720
     tcacctgtga cctgtttatc gccctggatg tgctgtgctg cacttcgtcc atcctgcacc       780
     tgtgcgccat cgcgctagac aggtactggg caatcaccga ccctatagac tacgtgaaca       840
     agaggacgcc ccggcgcgcc gctgcgctga tctcgctcac ttggctcatt ggctttctca       900
     tctccatccc gcctatgctg ggctggcgca ccccggaaga ccgctcgaac cccaacgagt       960
     gcaccatcag caaggaccac gggtacacca tctactccac tttcggcgct ttctatattc      1020
     cgctgctgct catgctggtc ctctatgggc gcatcttcag agccgcgcgc ttccgaatcc      1080
     gcaagacggt caagaaggtg gaaaagaagg gagcgggcac cagcttcgga acatcgtcgg      1140
     ccccgccccc caagaagagc ctgaatggtc agccaggtag tggggactgc aggcgcagtg      1200
     ctgagaacag ggcggtgggg actccgtgcg ctaatggggc ggtgagacag ggtgaggacg      1260
     acgccaccct ggaggtgatc gaggtgcatc gagtgggcaa ctccaaaggg caccttcctc      1320
     tgcccagcga atcaggagct acctcctatg tccccgcctg cttggagaga aaaaatgagc      1380
     gcactgctga ggcaaagcgc aagatggcct tggcccgtga gaggaagaca gtgaagacac      1440
     tgggcatcat catgggcacc ttcatcctct gctggctgcc ctttttcatt gtggccctgg      1500
     tcctaccttt ctgtgagagc agttgccaca tgcctgagtt gttgggtgcc ataattaact      1560
     ggctaggcta ctccaactcc ctgctcaacc cagttattta tgcttatttc aacaaagact      1620
     ttcaaaacgc ttttaagaag atcatcaagt gcaagttctg ccgctgatga tgatgatggt      1680
     ggtggtagtg gtggtaatag tggtggtgat ggagaaggaa gaagtggagg aagagtgtag      1740
     ggcttacagg acccttcctg ttcactcaat atccccgccc tggaagcaac acctaagaaa      1800
     acttgctttt cctagaacac gcagcttctt agcccatggc tttcagatct tctctctcta      1860
     tctcatttta aggggacagt gctttttgca gaaatcttag agaaccccta gcatctgttt      1920
     gtaaaattat tggctcggtc tttggcccta ggatcagttt tgatagttgc aataacctcc      1980
     tctctattcg aaatcccaat tcttcacgat ggaagtttaa acctcggcga ttcaaggaag      2040
     aaaacccaaa cagaaaatat aaactgtatg gacatctacc atgcccacta ggactgccac      2100
     cctctgccct atatctggaa ctttgaggtt caagactgct ctgtctctcc ctccctcttg      2160
     ctctagaaac atctgttccc tttgggtgtc aatgtacact gctgattctg gtctccatgc      2220
     actcacggct ggtctgggaa agttggaact actttgggtt atggtgccct ggaattgttt      2280
     gccttgctga atagcaaaag atccctttcc ccaatgcaca gcacccactt tctgtatttt      2340
     gtttgtttgt ttgttttaac tcaaaatcaa gtgacaaaga tgtctgctgg agtggactta      2400
     taagcaagaa gccaggccca aaaggaagag ccaagaaggc ctgcggatgt tttcctgtcc      2460
     tggtgtcagc actcaccaaa gaaattgaca atcagactat ttggaaggaa gagttttatt      2520
     cctgtagttt gttggctttt ctgtaagttc tggaaaggcc ttgtggactg cagaaggcgc      2580
     ccactgctgg ccagggaggg ctcattgagg gtgctgagat gcccgggatg gctcacctca      2640
     ccctcagttt cttttctagg agtgagctat gccagagcag ctcaccttga gtttgcagcc      2700
     tccgggttcc tccactcacc tctcacagta tccaggagct agtagagaag tttgagtttg      2760
     tgcaagaggt tggagactta gaatttctaa ggaagtgtgg gtgtgaggca cgtagaggag      2820
     gtaaggagca aaagggctcc taagtgcttc caactcctgc ggcgtgccca gggggtgggg      2880
     gtgacctaaa ggggcaattt taagcatagg atgcaaagtt tctcaatcta ccccttcccc      2940
     ctttcaagga acagcattgt gtagcatttc ctaaaaatgc ccggatttat tctccgggac      3000
     attctgtgct cacacaaatt tcgcagatct ctgggctctc attgtgaagg gtatcaacac      3060
     ctcaccatta cctacctagg atcttgatct cagagaccta aaagagagag cgatctctgt      3120
     ggagtcccag ccaagtcagc ccccaaattc tgagggtaaa accagttttg tgtcctctca      3180
     atttttaaag catttttctc cgctaggggt tcttttcctg ctgttatttt tgctgtccca      3240
     cccccacctc agagaagaaa attatttagg tgcttccttt gaatgtacat ttctagctaa      3300
     gtgagagggc atcaaatggt tttgcgttat atctgaactt cgaattttct gttgaataat      3360
     ggtttccttt tcaagcaatt atacggagat ttttttcacc ccccatcccc ttcagctgta      3420
     tctttccaat gtctgcacct gctgttttga aaacccgtgc tgcatttttt tttaaattgc      3480
     caaagttgct ggtgagatct cccccttgtg tttataaaca gggagaaagg actgccctgc      3540
     cacatgaagc cattgttttt atttgttaaa ctgagcaaag tttcttttgc tctactctaa      3600
     agtgggaatg agtattacag tcccttgcaa cagagccatt tcagaatgta agcctgtagg      3660
     gtgtccacac ctgagagact gacagggggt tctgtggaga agacgcactg ggctgggctt      3720
     ctccagtaca aacagtactt gtttgtaaat ttagcttgct ttatttgttt gtttgtttat      3780
     ttatttatca caaaaatgaa gtagaactat atggccaaat aatatttttc tgtatgcttt      3840
     actattttta gaccagatca tttacttgaa ataaagatca tttacttg                   3888
//