spacer

EBI Dbfetch

ID   AK049646; SV 1; linear; mRNA; HTC; MUS; 4027 BP.
XX
AC   AK049646;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 12 days embryo spinal cord cDNA, RIKEN full-length enriched
DE   library, clone:C530014G19 product:twisted gastrulation protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4027
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 36800a694fc833835c88dc424fb35da9.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C530014G19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4027
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C530014G19"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             153..821
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="twisted gastrulation protein (MGD|MGI:2137520
FT                   GB|NM_023053, evidence: BLASTN, 99%, match=3976)"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="BAC33857.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
XX
SQ   Sequence 4027 BP; 1060 A; 887 C; 925 G; 1155 T; 0 other;
     gagcccggcg cgggcctggg agcggccggg gacagcgcgg gcctgtgtgt ccgcggcgcc        60
     ggggttcgcg ggagctgctt ggaggctcgg cggccgggag gaggccgggg ccacgcttct       120
     tggaagctac tgagtgactt ctttgaagaa ccatgaagtc acactatatt gtgctagctc       180
     tagcctccct gacgttcctg ctgtgtctcc ccgtgtccca gagctgtaac aaagcactct       240
     gtgccagcga tgtgagcaaa tgcctcattc aggagctctg ccagtgccgg cctggagaag       300
     ggaactgccc ctgctgtaag gagtgcatgc tgtgcctcgg ggccctgtgg gacgagtgct       360
     gcgactgtgt cggtatgtgc aaccctcgga attacagcga caccccgccc acatccaaga       420
     gcaccgtgga ggagctgcac gagcccattc cgtccctgtt cagggcgctg acggagggcg       480
     acacccagct gaactggaac atcgtctcct tccctgtggc agaggagctg tcacaccatg       540
     aaaacctagt ctccttccta gaaactgtga accagctgca ccaccaaaac gtgtctgttc       600
     ccagcaacaa tgtccacgcc cccttcccca gcgacaaaga gcgcatgtgc acagtggttt       660
     actttgatga ctgcatgtcc atccaccagt gtaagatatc ctgcgaatcc atgggtgcat       720
     ccaagtatcg ctggtttcac aacgcctgct gcgagtgcat cggtccagag tgcattgact       780
     atgggagtaa aactgtcaag tgtatgaact gcatgtttta aagaggggga agaaatgcaa       840
     accaaagcag taagtcatga agtgtgcaga aatcttggtt ctggtatgct aggagtgtgt       900
     taagttatat gattgtaact gtgcttttta tatctggtgc ctattagtgt aggtcttttc       960
     cattggattc aatggaactt tagtcacatg aggatcggga gttcagagga gtcctgggaa      1020
     aacctgacat gctgacagaa ggtgccgtct tcttccagct ttccaaacac ttctcgtttt      1080
     gaacgtgata gcacaagcct ggtacatgtg tggttctcac ctgccagttg tagaacacta      1140
     ggtccctata gtcacacatc tcttaattgt gccttggctg gcttacctgt tttgtatgag      1200
     taaatattac agtttataat tctaacaact cacattcaag ccatgctgaa acttaatttc      1260
     aaaccacttt acattggttt tagaaagtaa atatttacta tattttacaa cagaagagtt      1320
     ttgcctaggg ccagcgagct gactcagtgg ataaaggcgc ttgctaccaa gcctgataac      1380
     ctgagttcca tccccagagc ccgtacagtg gaaggacagg accagctgct gggagttgtc      1440
     ctctgacctc cagacaggca cagtatcatg cgtggaggtg tgcttgtgtg tgcacacaca      1500
     taactaactg tttttaaaaa tataaacctc ttacatggtg aaatctaaat ctgtcgtgta      1560
     gctctcacac tgacagtggt ttggatgtta tgtcccctgt ccgcctgtag tgctggtgtg      1620
     gtgagacaca gagtcgtcac tgctctggta tagaagagtt ttgtctacca agagtgtcat      1680
     ggcatacctt tggaacttca tcaaatgcac ttgaggatga cctgggtcag gaagtagcca      1740
     ggtaaaagca gcgggactgt aggcgatgct ccattagact ccgtgcagag cagcaggtgc      1800
     acagcatagc tgggtgtgcg gctgaccagg agagggtctg actccgcacc agcagaacag      1860
     cagggtctcc agcacgtgtg ggaagcacgt gggagagggt tgaggaagga tgcacagatg      1920
     tggacagaga agcataaaaa tgtcgggaac tcctagtagg gtccacctta aaatcgcttt      1980
     atagtctctg gctttgttac tctgtaagat tacacttgtt tctggatatc tgaatccaaa      2040
     taagcatcat attttaagaa gctctgtttc tgaacttcca gggggaaatc tgtttaatgt      2100
     gtttactcct agcatactac agaattttct agctctatag cttcttacct agcgtttcca      2160
     tagtgctgag cttcattact acacgccctt cctagtaata aaattctcac cttcaagcat      2220
     gaatcaaaaa caaatatcta taatacacag gttcaatttt atagaattgc tattttctct      2280
     agtgcatatc tcattaaaag taacttttta ggaataatct ttatatgggt acatattttg      2340
     gtacataaaa tagaaaatgt tcttaaactc attttgtatt atttgaatag ttacaagatg      2400
     atttgtggta tcatgggtac ccattataaa ccatgctctt cccagtagct gacgaactca      2460
     aggtatcaca gccttctaag aagccgactt agaacatggc tgtacatgaa tattatacat      2520
     taaggtgtcc tctcacttct acccagagtg cctctgttca aaggtgcctt ggaaacattt      2580
     cagccccttc cttcttagct cccacagggc tgtgggtgtt cttgaaatca ggaggcgttt      2640
     tgaaggacca cagctgctcc atttcagccg ctgattctta ggaaagttca tgctctgaca      2700
     gaagtgtgct ttgatggctt ctagcggtgc atctcgtctc gttttctttg tttgtttttg      2760
     ttgttgctat catggtttgg tttggttttg agacaggatc tctgtgcagc cctggctggc      2820
     ctggaatgta ctatgtagac caggctggct ctcctcatgt tttcttagtg atggccataa      2880
     acattgttaa aatacatcac catcttttaa aaacttttca ttattaaaat ttaaaatata      2940
     gcatgtcatt tttttacccc atacatttgc tatgaaaaat tttttaaacc acctgcttta      3000
     acttttttat tgccctgttt ttcctattag aattgatccc cactgaggta aattttataa      3060
     tcatgttttg tgtatttttc ctggctcgcc aaggcttatg aagaaatagc agccattccc      3120
     tgacaggttt gcgctcccac cacagagagg ctgagcaaga tgatcagagg atcaaggcca      3180
     gccagagcaa ggcactgccc agaaagcaca agtcctgtgc tcagcgtttt gcgtagcgtt      3240
     ttattcctaa ttgaaatgta atatttcaga agctagcagc ctcgctcagt ctagaccttc      3300
     cacaccaatc tagcagcgat tctcccgtac taaagccttt gtaagagttt acggttcttc      3360
     ctcagtgaaa aatgatcttg tttttcttac agccggatcc aaagacgcta gatgttaagg      3420
     gctgaggctg aagcccggtg acggggcgct cacctgtcat ggtgcagccc tcgttccacc      3480
     gtgagcacca gcaagagaca aacacaagct tgtgagtcag aggccgttat taaattcata      3540
     cgcacatact ccctatagcg agacatgggc ttatgggcag gctttttttt cataacattt      3600
     atgagaaaac aatgttttcc ccataacatt taattaggac tgtagcttat tggtaattaa      3660
     ggtacaaaat caaagtcgag tagaatgtac tgttcacaca gcgtgttgtg aaaggggtcc      3720
     tcacaccaaa gtttaactgt aaagtttaga aaaataacat tgtcattagc atatttgaac      3780
     acatatttgg aatttctaaa aagcatcaaa atagaaaaag aaagtgaaac tctggagaat      3840
     gagatgctga agatgggcta tgatttaaag gtctgttctg tagttagaaa gcacctttta      3900
     aagactttgt tcattcccaa gagtctatgt tgattgcatt taacatgacc gacaacttat      3960
     atatgtaatt gtgtacattt tcattggttg tctctgtagt ccaaaagaag gtattttaat      4020
     aaaaaat                                                                4027
//


spacer
spacer