spacer

EBI Dbfetch

ID   AK049548; SV 1; linear; mRNA; HTC; MUS; 1352 BP.
XX
AC   AK049548;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 7 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:C430024E13 product:lipoic acid synthetase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1352
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c24be8e5d7a66d4934c3f36dee31a966.
DR   Ensembl-Gn; ENSMUSG00000029199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031101; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C430024E13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1352
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="7 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C430024E13"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             48..1169
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lipoic acid synthetase (MGD|MGI:1934604
FT                   GB|NM_024471, evidence: BLASTN, 99%, match=1338)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q99M04"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="MGI:MGI:1934604"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M04"
FT                   /protein_id="BAC33804.1"
FT                   /translation="MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQ
FT                   DFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTV
FT                   CEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTA
FT                   KAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAV
FT                   EKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGL
FT                   GETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFL
FT                   YTASGPLVRSSYKAGEFFLKNLVARRKTKASKV"
XX
SQ   Sequence 1352 BP; 393 A; 281 C; 366 G; 312 T; 0 other;
     ggctgttccc tcgatccctt gacactcctg agacctaaaa gagggggatg gctctacgct        60
     gctgggatac agctcgcagc ctggggtccc ggatatttgg aagatatgcg ttcacggtta       120
     gagcattaag ttctttgcca gataagaaaa aggaattttt gcataatgga ccagaccttc       180
     aagattttgt atctggtgat cttgcagaca agagtacatg ggatgaatat aaaggaaact       240
     taaagcgcca gaaaggagaa aggctaagac tacctccatg gctaaagaca aagataccca       300
     tgggtaaaaa ctacaataaa ctgaaaaata cattgcggaa tttaagtctc cacacagtgt       360
     gtgaggaagc ccggtgcccc aacattggag agtgttgggg aggtggggaa tatgccacag       420
     ccacagccac gatcatgttg atgggggaca catgcacaag aggttgcaga ttttgttccg       480
     ttaagaccgc aagaaatccc cctccattgg atgccaatga gcccgacaat acggccaaag       540
     caattgcaga gtggggtctg gattatgttg tcctgacgtc ggtggatcga gatgatgtgg       600
     ccgacggggg agctgagcac atcgccaaga ccgtgtcatg cttgaaggaa aggaatccaa       660
     aaatcctcgt ggaatgcctc accccagact tccgaggtga tctgagagca gtggagaagg       720
     tggctctgtc tggattagat gtgtatgcac acaatgtgga gactgtcccc gagttacaga       780
     ggaaagttcg tgatccccgg gccaattttg accagtctct tcgtgtactg agacatgcca       840
     aggaggtcca gcctgatgtt gtttccaaaa catcgataat gctgggcctt ggtgagacag       900
     acgagcaagt ctatgccaca ctgaaagctc tccgtgcggc cgacgtggac tgtttaactc       960
     tagggcagta catgcagcca acgaagcgcc accttaaggt tgaagaatat gttactcctg      1020
     agaagttcaa atactgggaa aaagtaggga atgaacttgg atttctctat acggcaagtg      1080
     gtcctttggt gcgatcttca tataaagcag gtgaattttt cctgaaaaat ctagtggcta      1140
     gaagaaaaac aaaagcttct aaagtgtagc caagcccttc aagatcacag gagtgttgcg      1200
     attttgcttc cagttggtgt gaggatggtg tcaccctgtc aggattcctg tgagtgcaag      1260
     gcagcaccgt tctgaagggt ctgatggctg atcgaagcgg aatggtgtat acctgtaatt      1320
     ccacccagaa aaaaaaaaag gaaaagaaaa ag                                    1352
//


spacer
spacer