Dbfetch

ID   AK049372; SV 1; linear; mRNA; HTC; MUS; 3684 BP.
XX
AC   AK049372;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:C330037A16 product:adenylosuccinate lyase, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3684
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 73c64098858d3434a8df95cf19f07fcf.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022104; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022065; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022071; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021842; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022514; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021363; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021807; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021936; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021914; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022004; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021934; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022528; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021105; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021415; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0041771; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0041735; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041767; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041501; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042250; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041576; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0041407; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0041566; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0041536; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0041629; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041509; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042284; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041158; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040896; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C330037A16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3684
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C330037A16"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             31..1485
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylosuccinate lyase (MGD|MGI:103202 GB|NM_009634,
FT                   evidence: BLASTN, 99%, match=1864)"
FT                   /note="putative"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54822"
FT                   /protein_id="BAC33717.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
XX
SQ   Sequence 3684 BP; 969 A; 874 C; 919 G; 922 T; 0 other;
     ggtccgccgc gtcctggtcg cgtgttgaaa atggctgcat ccggcgaccc tggcagtgct        60
     gaaagttacc gttctccgct ggcggcccgc tacgccagcc gcgagatgtg tttcttgttc       120
     agcgacaggt acaagttcca gacgtggcgg cagctgtggc tgtggctggc ggaggccgaa       180
     cagacgctgg gtttgcctat cacagatgaa caaatccagg agatgaagtc gaacctgaac       240
     aacattgact tccagatggc agctgaggaa gagaagcgcc tgcggcacga cgtgatggct       300
     cacgtgcaca cgtttggcca ctgctgtccg aaagctgcgg gcattattca tctgggcgcc       360
     acctcctgct atgtcggaga caatacggac ctgattattc tgagaaatgc atttgaccta       420
     cttttgccaa agcttgctag agtgatctcg aggcttgccg actttgctaa ggatcgtgct       480
     gatctgccca cgttaggttt cacacacttt cagcctgctc agctgaccac ggttgggaaa       540
     cgatgctgcc tttggattca agatctctgc atggatctcc agaacttgaa gcgtgtccgg       600
     gatgagctgc gcttccgagg agtaaagggc accactggca cgcaggccag cttcctgcag       660
     ctcttcgagg gggatcacca gaaggtggag cagctggaca agatggtgac agaaaaggca       720
     gggtttaaaa gagccttcat catcacagga cagacgtaca cacggaaagt ggacatcgaa       780
     gtgctgtctg tgctggccag cttaggagca tcggtgcaca agatttgcac tgacatacgc       840
     ctgctggcaa acctgaagga gatggaggag ccctttgaga aacagcagat tggctccagt       900
     gcgatgccgt acaagcggaa ccccatgcgc tccgaacgtt gctgcagcct ggcccgtcac       960
     ctgatggccc ttaccatgga cccactacag acagcgtctg tgcagtggtt tgaacgtact      1020
     ctggatgaca gtgccaaccg acggatctgt ttggctgaag cgtttctcac tgcagatact      1080
     atattaaaca ccctacagaa catttctgaa ggattggtgg tgtaccccaa agtaattgaa      1140
     cggcgcattc ggcaagagct gcctttcatg gccacagaga acatcatcat ggcaatggtg      1200
     aaagccgggg gcagccgaca ggactgccat gagaaaatta gagtgctttc ccagcaggca      1260
     gctgctgtgg tcaagcagga aggaggtgac aatgacctta tagagcgcat ccgggcagat      1320
     gcctacttca gccccatcca ctcacagctg gagcacttgc tggacccctc ttctttcact      1380
     ggccgagcac cccagcaggt ccacagattc ctggaagagg aagtgcgccc cctgctaaag      1440
     ccctatggga atgagatggc ggtgaaagca gagctgtgtc tgtagagtag gagagctgag      1500
     gagaacccgg ttacagtgat tagagcttgc tgattacagt gttagagtta ctactgtgtt      1560
     ctgcggcact cctttacaca ctcaggaggc agaggcaggc agatctctga gttcaaggcc      1620
     agcctggtct acaaaacaag ttccaggaca gccagagcta cacagagaaa ccctgtctca      1680
     acaaacaaac aaacagaggc tggggacatg gcactgactg ctcttccaaa ggtcctgagt      1740
     tcaaatccca gcaaccacat ggtggctcac aaccatctgt aatgagatct gatgccctct      1800
     tctggtgcat gaagacagct acagtgtatt catatacata aaataaatga atctttaaaa      1860
     acaaacaaaa agaatgtaca ttaagttctc ttgcttgggg ttcacaacag atagccgtgc      1920
     tttcttgttt tctccagtct tttgttgttg agacagagtc tcaatgtgta tcattggctg      1980
     acctggaaca cagaaatctg cctcatctcc ccagtggcag gattaaaggt gtgctccacc      2040
     atgcctggct gttttatatt ttttacagca acataatctt gcagaataat gtagctcata      2100
     cttattttcc agatgccttg agtctacaat gtttcctcac ttacagtgag attgtgtcac      2160
     cataaggaaa tgagttcagt tcacctatca aacattgtta tgtgctcata acacttgaca      2220
     gtaacttctg gtccaagatc ccctaacaaa ctgtattagt aatacagtca aatgcctagt      2280
     gttgtttact gagtcctatg caggtacact ttgccacaca ctaggctaga ctcttcctgt      2340
     agtccttttc aagtatttac ttgattgtaa agtagcaaga aattcctgga ttcatgagtc      2400
     acatcatcag atcccttgat ttcaattctt tctgcccagg ttaaataata tttaacctga      2460
     cgtttgtagc taaggatgga tattgttggg tccctcaggt gcctattcca tcttttacag      2520
     aggttgcctt ctcaggacaa tgctaactgg gtaaactgat tgcattatgg aacctcccag      2580
     cctcttagcc ttgttaagta gataggtagc tatttggaca agctagtcaa aaggtgagtt      2640
     atgaaaagac caagaccagc cggaagagga acattcgcct tgccttgggc tgtgtatttt      2700
     ggtgtgttgg tgtgtgtgga attgaagggc tggcaagatg gctcaactag taagggcctg      2760
     ttgtgttggg ggtgggggga atccacaaac ttgttctctg acctccacca ataatagtga      2820
     agtggtttaa gtgagcaaag ctgttgtggt agcacataac cgctagaagc tgcccaagcc      2880
     tgccgtggtc acttacacta ggtggcccca acctttgctc ctagtccccc gtccccttca      2940
     gaaagcccaa ctctttggcc acccctgccc ggccagagct ctgtagatct ctgcagatga      3000
     gagtctggta cacagaccaa catacacagt ttcagggcag tccagagact gccacaaaac      3060
     agacatgaag attctgttga tcagattttt agttgacaag aactaggaga attaagcaac      3120
     ttggtaacaa ctgagatttc atctggcaag gataaatgta aacaaacctt aaactccgta      3180
     gcagccagga aacatggtag tagtgtcctg aaaggtcacc tgataatatg ccacattcag      3240
     tatttgttca atcttgattg gatccaaaga gaaacctctg actttaagac tccagcatct      3300
     tttgaggtct tagtgtatgt ggacttctcc atgctggcct tgaaatgtag ctcagcctcc      3360
     agggtgtgga ggtgacaggt gtgctgtttg gtagactgat ccagcaagag tgacctacaa      3420
     ccccaacctc tgtctaggaa ggagctaaag acaatgttgt tgtcaggagt gtttgtctaa      3480
     gtctgtgctc gtaggtatcc agaatctcaa cttgtcttaa tatcccagca ctaaggaggc      3540
     tgaggcagga ggattgccgt ggagataatt cccacagact acatagtgta cagattgaga      3600
     taatcagtgt ttaaaaaaaa aaaaaaatct gtctcagtgg taccatgctg acttggccct      3660
     ccttcagtaa aggaatcctg cagc                                             3684
//