spacer

EBI Dbfetch

ID   AK049110; SV 1; linear; mRNA; HTC; MUS; 2169 BP.
XX
AC   AK049110;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:C330002D02 product:LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR
DE   (LIPOCALIN-INTERACTING PROTEIN) homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2169
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e18e352c9d1e1a0b14166ee48d5ee231.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C330002D02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2169
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C330002D02"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             179..1648
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR
FT                   (LIPOCALIN-INTERACTING PROTEIN) homolog [Homo sapiens]
FT                   (SPTR|Q969J4, evidence: FASTY, 95.1%ID, 100%length,
FT                   match=1467)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="BAC33547.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
XX
SQ   Sequence 2169 BP; 395 A; 626 C; 617 G; 531 T; 0 other;
     gaagggcggg gcgtccgacc gcagaatctg agccccagat taccttgagt ttccgtcacg        60
     ggcagcgagg agaggcgctt aggctgggtc cgggtgcttg gcgggcggcg gcggcctcat       120
     ccccgctcgt cctccccggg cccggagaca cccccgcccc agtcatgctg agcagagtat       180
     ggaagcagct gactacgaag tgctatccgt gcgagaacag ctgttccacg acagggtccg       240
     cgagtgcatc atctcaatac ttctgtttgc aacactctac atcctctgcc atatcttcct       300
     gacccgcttc aagaagcctg ctgagttcac cacagtggat gatgaagatg ccacagttaa       360
     caagattgcg ctggagctgt gcacctttac cctggcggtc gccctgggcg ccgtcttact       420
     cctgcccttc tccatcatca gcaacgaggt gctgctctcg ttgccacgca actactacat       480
     ccagtggctc aatggctccc tcatccatgg tctgtggaac ctcgttttcc tcttctccaa       540
     tctgtccctc gtcttcctta tgccctttgc atatttcttc acagagtctg aaggctttgc       600
     tggctccaga aagggtgtcc tgggccgggt ctacgagaca gtggtgatgt tgatcctcct       660
     cacgctgctt gtgctgggca tggtgtgggt ggcatccgcc attgtagaca atgacaaggc       720
     cagcagggag tcgctctacg acttctggga gtactacctc ccctatctct actcctgtat       780
     ctccttcctc ggagttctgc tgcttctggt gtgcactcca ctaggtctcg cccgcatgtt       840
     ctctgtcact gggaagttgc tggtcaagcc ccggctactg gaagacctgg aggaacagct       900
     gaactgctca gcctttgagg aggcagctct gactcgaaga atctgcaatc ccacctcctg       960
     ctggctgcca ctggacatgg aactgctgca tagacaggtc ctggctctgc aggcacagag      1020
     ggtcctcttg gaaaagcgtc ggaaggcgtc agcctggcaa cggaacctgg gctaccctct      1080
     ggccatgctg tgcttgctgg tgctgacggg cctgtctgtc ctcatcgtgg ctgtccacat      1140
     cctggagctg cttattgacg aggctgccat gccacggggc atgcaggatg ctgccctagg      1200
     ccaggcctcc ttctccaaac tgggatcctt tggcgccatc atccaggttg tgctgatatt      1260
     ttacctgatg gtgtcctcag tggtgggttt ctacagctct ccactctttg gaagcctgag      1320
     gcctaggtgg catgacacat cgatgacaca gatcattggg aactgtgtct gcctcctggt      1380
     cctcagctca gcacttcctg tcttctctag aactcttggc ctgacacgct ttgacctgct      1440
     gggtgacttt ggacgcttca actggctagg caatttctac atcgtgttcc tctacaacgc      1500
     agcctttgct ggcctcacca cactctgtct ggtgaagacc ttcacggcag ctgtgagggc      1560
     agagctgatc cgagcctttg ggctggacag actgccactg cctgtctctg ggtttccccg      1620
     ggcttctagg aagaagcagc atcaatgacc tccagctggg ggctgagaag gagagaactg      1680
     ggcagtgcct aggcctggcg gtgagcccca gggggctgca cctcaggacc tggaacctga      1740
     gagtaggtga cagaggggac ggaccatctg cactgttgct taatctgagc cagagtttgg      1800
     gacccggctg gcctcctgcc ttttcagatg tagctgtggc ctgagcatcc atctggtgga      1860
     gctgggggac tcgctctagt tcctggaccc aaatacgttt acacatctat ctgcctcaat      1920
     cctgttccag gccatgcctg aagccatgtt tacatgattt gatgtgcaat agggtgggtg      1980
     ggacttgggg ggactgggcc aggggtaggt tctggagaca ggtcttcctt gcctctggcc      2040
     cagaagagcc gaagcactgt gctatcctgt ggagggcttt ggaccactgg agagaccaag      2100
     ggtgctggga ggaggcggct gcacccacga gcaataaaat tgatcccagg gttttcttgg      2160
     ttcttttgc                                                              2169
//


spacer
spacer